KEGG   Sulfurimonas denitrificans: Suden_0440Help
Entry
Suden_0440        CDS       T00298                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00900  Terpenoid backbone biosynthesis
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Suden_0440
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Suden_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABB43721
UniProt: Q30TG0
Position
441872..442672
Genome map
AA seq 266 aa AA seqDB search
MKMKLYRAYAKVNIFLKIQGSRGNYHEIVSRFMRVPSLYDELSFVPKESSEEFELIGSFS
CKREQNTIYKAYRALLEFLDEASGLHVENLMQKYAVKVTKNIPTFAGLGGGSSDAATFLK
MCNEVLHLGLSQNELALIGLHVGADVPFFIYGYNSANVSGIGEVVEEFKEELLDIEVFTP
QLEISTPKVYNLYRENFYNPVDGFEVERLKKISSKDALSAMSAAEANDLFAPAIQLYKEL
KNHYKYGYYFSGSGSSFFRVKEKENI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagctttatagagcttatgcaaaagtaaatatttttttaaagatacaaggc
tctagaggcaattatcatgaaatagtatcaagatttatgagagtcccttctctttatgat
gagctctcttttgtccctaaagagagtagtgaagagtttgaattaatcggctcattctct
tgtaaaagggaacaaaatacaatatacaaagcatatagagcactgcttgaatttttagat
gaagcaagtggactacatgtagagaacctaatgcaaaagtatgcagttaaagtaactaaa
aatatcccaacatttgcaggacttggtggaggaagcagtgacgctgcaacatttttaaag
atgtgtaatgaagttttgcatttgggacttagccaaaatgagttagctctaattggtttg
catgttggcgcagatgttccatttttcatttatggatataacagtgcaaatgttagtgga
attggagaggttgttgaggagtttaaagaggagctcttggatatagaggtctttacgcca
cagcttgagataagtactccaaaagtttacaatttgtacagagaaaatttttataaccca
gtagatggatttgaagttgagagacttaaaaaaatatcatcaaaagatgctctaagcgct
atgagcgcagcagaagcaaatgatctttttgcgccagcaatacagctttataaagagttg
aaaaatcactacaaatatggatactacttcagtggaagcggaagcagtttttttagagta
aaagagaaggaaaacatataa

DBGET integrated database retrieval system