KEGG   Sulfurimonas denitrificans: Suden_1065Help
Entry
Suden_1065        CDS       T00298                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00450  Selenocompound metabolism
tdn00970  Aminoacyl-tRNA biosynthesis
tdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Suden_1065
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Suden_1065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tdn01007]
    Suden_1065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tdn03016]
    Suden_1065
Enzymes [BR:tdn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Suden_1065
Amino acid related enzymes [BR:tdn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Suden_1065
Transfer RNA biogenesis [BR:tdn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Suden_1065
 Prokaryotic type
   Other AARSs
    Suden_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 NOB1_Zn_bind MqsA_antitoxin
Motif
Other DBs
NCBI-ProteinID: ABB44343
UniProt: Q30RN8
Position
1127367..1129301
Genome map
AA seq 644 aa AA seqDB search
MSKYITTPIYYVNGEAHIGHAYTTFIADTLARYEKLKGEDTYFLTGTDEHGQKIEESAQK
NSKPTQEFADEISASFKNLWDEFDISYDKFIRTTDAEHKKGVQRAFEVMYAKGDIYKDFY
EGHYCVSCETFFTETQLVDGEFCPDCGRSTNIVKEESYFFRLSKYENALLKHYEENPDFI
LPRSRANEVINFVKGGLRDLSVTRTSFTWGVGMPNSIKDDKHVMYVWLDALMNYITALGY
GTTEENMRYWPASVQFVGKDILRFHAIYWPAFLMSIDLPLPQHIGAHGWWTRDGEKMSKS
KGNVISPKQVADVYGVENLRYFMLREVPFGQDGDFSQRAFIDRINSELSNDLGNLLNRII
GMSGKYSDFEIESVNVLKYHKKEIDAMNVVLDSLDIFMKNFQTHRYLEELWKLFSIGNKA
IEEHAPWVKMKDGKKDEALSTVALVANILAKASIMLHPVMPRTTDIIADALNFSISHESY
RELVQEKKLLKLFNIKPVPPLFPRVDEPLMPEAPLAQPNITKESVKAAEQSLCEGDNLIE
IGQFFQTSLKVGTVIAAEEVEKSKKLLKLQVDLNEGKPRQVVAGIREFYSAESLINTQVC
VVANLKPAKLMGMISEGMLLAAKDEDGLCLIRPEKPKKAGTPIG
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaatatataacaacacctatctattatgttaacggagaggctcatattgggcat
gcttatactacttttatagctgatactctagctagatatgagaagctcaaaggtgaagat
acctattttttaactggtactgatgaacatggtcaaaaaatagaggagtctgctcaaaaa
aattctaagccaacacaagagtttgcagatgagataagtgcctcttttaaaaacctttgg
gatgagtttgatataagctatgataaatttattcgtacaactgatgcagagcataaaaag
ggtgtccagagagcctttgaagttatgtatgcaaaaggtgatatatataaagatttttat
gagggtcactactgtgtaagttgtgagactttctttactgagacgcaactagtcgatggt
gaattttgtcctgattgtggcagaagtacaaatattgtcaaagaggagagttactttttt
aggctctctaaatatgaaaatgcccttttaaagcactatgaagagaaccctgattttatc
cttccacgttctcgtgcaaatgaagttataaactttgtaaaaggcggacttagagatttg
tcagtcacaagaacatcttttacatggggtgtcgggatgccaaactctataaaagatgac
aagcatgttatgtatgtttggcttgatgctcttatgaactatattacagctcttggatat
ggaactacagaggaaaatatgcgttattggccagcttcagtgcagtttgttggaaaagat
atacttcgttttcatgcaatctactggccagcatttttaatgagtattgatttgcctctt
cctcagcatataggtgcacatggatggtggactagggatggcgagaagatgagtaaatca
aaaggcaatgttatctctccaaaacaagttgctgatgtttatggcgttgaaaatttaaga
tattttatgctcagagaagtaccttttgggcaagatggagacttttctcaaagagcattt
atagataggataaactcagagttaagtaacgaccttggaaaccttttaaatcgtatcatt
ggtatgagtggtaaatactcagattttgagatagagagtgttaatgttttaaaatatcat
aaaaaagagattgatgcgatgaatgtcgtacttgattcactcgatatttttatgaaaaat
tttcaaacgcatcgctatttagaggagttatggaaactattttctatcgggaacaaagcc
attgaagagcatgctccatgggttaagatgaaagatggaaaaaaagatgaagcgctctct
actgtagcacttgttgcaaatattttagcaaaagcgtctattatgcttcatcctgttatg
cctcgcactacagatattattgcagatgctctaaacttttctatctctcatgagagctac
agagagcttgttcaagagaaaaagcttttaaaattgtttaatattaaacctgttccacct
ctatttccacgtgttgatgagccgcttatgcctgaagccccacttgctcaaccaaatatt
acaaaagagagcgtgaaggctgcggaacaaagtctgtgtgagggtgataatcttatagaa
attgggcaattttttcaaacttctctcaaagttgggacagtaatcgcagcagaagaagtt
gagaagagtaaaaaacttctaaaacttcaagttgacttgaatgaaggaaaacctagacag
gtagttgctggaataagagagttttatagcgcagagtctcttataaatactcaagtttgt
gttgttgcgaacttaaaacctgcaaaacttatgggaatgatctcagagggaatgcttctt
gctgctaaagatgaagatgggttgtgtttgatacgacctgaaaaacctaaaaaagcaggc
acgcctattggatga

DBGET integrated database retrieval system