KEGG   Sulfurimonas denitrificans: Suden_1086Help
Entry
Suden_1086        CDS       T00298                                 

Definition
(GenBank) aspartate--tRNA(Asn) ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tdn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Suden_1086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tdn01007]
    Suden_1086
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tdn03016]
    Suden_1086
   03029 Mitochondrial biogenesis [BR:tdn03029]
    Suden_1086
Enzymes [BR:tdn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Suden_1086
Amino acid related enzymes [BR:tdn01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Suden_1086
Transfer RNA biogenesis [BR:tdn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Suden_1086
 Prokaryotic Type
   Other AARSs
    Suden_1086
Mitochondrial biogenesis [BR:tdn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Suden_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ABB44364
UniProt: Q30RL7
Position
1146459..1148201
Genome map
AA seq 580 aa AA seqDB search
MRSHYCTELSEANIGQEVVLAGWANSYRDHGGIIFIDLRDKSGLIQLTCDPEDSASSHKI
ASSIRDEFVLVAKGKVRLRGEGLTNPRLKTGAIEIVVSELTIENRSAAVPFVIGDKNVGE
ETRLKYRYLELRDPSMYETFRLRSKAAIAARNILDENGFLEVETPILTKSTPEGARDYLV
PSRVHSGEFYALPQSPQLFKQLLMVGGFDRYFQIAKCFRDEDLRADRQPEFTQIDVEMSF
CNQEDVMLIAEKLLVSMFGACGVEIKPPFNRIAYRDAMEWYGSDKPDLRYDLKMVDVIDI
FERCDNEIFTNIAKQPHKNRIKALRVPGADLVFSKREMKTFEDFVRQFGAQGLGYFQMKE
DGLKGPLIKFFSDADIALLVDRLGMKVGDVVFFGAGDKKTVWDYMGRLRIFIAEHERMNL
ADKDAFEFVWVVDFPMFEVEDGRVKALHHPFTQPKDTDKDDIEEIDSIAYDIVLNGTELG
GGSIRIHKEEMQEEIFKLLGIGEEEAKEKFGFLLDALKFGAPPHGGFAIGFDRLMMLISK
KSSIRDVIAFPKTQKASCILTKAPSEVDATQLRDLHIKLR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtcattattgtacagaattaagtgaagcaaatataggacaagaggttgttcta
gctggttgggcaaatagctaccgagatcatggcgggattatttttatcgatttaagagat
aaaagcggattgattcagcttacatgtgaccctgaagacagcgcatcttctcacaaaata
gcaagtagtattcgtgacgagtttgttcttgttgcaaaaggtaaagttcgcctccgtgga
gagggacttacaaaccctcgcctaaagactggagcaattgaaattgttgttagtgaacta
actattgaaaatcgctcagcagcggttccatttgtgataggcgataaaaatgtcggtgaa
gagacaagacttaaatatcgctatttggagcttagagacccatctatgtatgagactttt
cgtcttcgttcaaaagctgcaatcgcagctagaaacatacttgatgaaaatggcttctta
gaggttgaaactccgatacttacaaaatcaactcctgagggagcaagagattatctagtg
ccttctcgtgttcacagtggcgaattttacgcacttccgcaatctccgcagctatttaaa
cagcttttaatggttggcggatttgatagatatttccaaatcgcaaagtgttttagagat
gaggatttaagagcagacagacagcctgaatttactcagatagacgttgagatgagcttt
tgtaatcaagaagatgtaatgcttattgctgaaaaacttttagtctcaatgtttggcgct
tgtggcgttgaaatcaagcctccatttaaccgcatagcttacagagatgctatggagtgg
tatggatctgataaaccagaccttagatatgatttgaaaatggttgatgttatcgatata
tttgagagatgtgataacgaaatatttacaaatatcgctaaacaaccgcacaaaaaccgt
ataaaagctcttagagttccaggtgcagatttggttttctcaaaaagagagatgaaaact
tttgaagattttgttcgtcagttcggcgcacaagggcttggatattttcagatgaaagag
gatggactaaaaggtccacttatcaagtttttctcagatgcagatatcgcacttctagtt
gatagactcggtatgaaagttggagacgttgttttctttggtgcaggtgataaaaaaact
gtatgggattatatgggtcgtcttagaatttttatcgcagaacatgagagaatgaatctt
gcagacaaagatgcttttgaatttgtatgggttgttgactttcctatgtttgaggttgaa
gatggaagagtaaaagcacttcatcatccatttacacaaccaaaagatactgataaagac
gacatcgaagagattgattctatcgcttatgatatcgttttaaacggtacagagcttggt
ggcggaagtatccgtatccataaagaagagatgcaagaggagatattcaaacttcttggc
attggtgaagaagaggcaaaagagaagtttggcttcttacttgatgctctaaaattcggc
gctcctccacatggcggttttgctattggatttgacagacttatgatgttaatttctaaa
aaatcaagtatccgtgatgttatcgcattccctaaaacacaaaaagcttcttgtatcctt
acaaaagcaccgagtgaagttgatgcgactcaacttagagatttacatataaaacttaga
taa

DBGET integrated database retrieval system