KEGG   Sulfurimonas denitrificans: Suden_1585Help
Entry
Suden_1585        CDS       T00298                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
tdn  Sulfurimonas denitrificans
Brite
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Suden_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_C7 Cytochrom_NNT Cytochrom_c3_2 PBS_linker_poly Cytochrom_CIII DUF1924
Motif
Other DBs
NCBI-ProteinID: ABB44862
UniProt: Q30Q69
Position
complement(1660826..1662019)
Genome map
AA seq 397 aa AA seqDB search
MKRLLFYTLIIAIMVLSVILSIAYLTPPKVIPQYSDDKLRELALFKGLKSTPNTYEKLLE
LVDDASNPMSASKIVLGEKLFFDVNLSKNRQTSCSTCHSFDRDLKNRGAMSKMINSPKEQ
TNNCVACHLRDQSGVDRFTFSQGDNQEPHPNLLNTQSILNTAFSKHFTWSGEVSSLRQQS
ENSFLAYHKMNITADELVLRVGKSEKYRAMFSTAFQDDITFENINKAIEVYVKTLVTRGA
YDRFLDGDNSAISSDAKRGLANFIGFGCKGCHSDISLGGQSIQRFPLRDFAQVYDLKPNF
ELFPEFKRFDGEFPFENSGGFLGKNKEHLFRVPILRNVTKTSPYFHNGAVPKIREAVNVM
AKHQLGRHLTLEQIDEIVAFLRTLEGDIIEYEIRENR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttactcttttatacacttataattgctattatggttctaagtgtgatttta
tccatcgcttatttgacacctccaaaagtgataccacaatatagtgatgataaattaaga
gagttagcgctatttaaaggtctaaaatctaccccaaatacctatgaaaaacttttagaa
cttgttgatgacgcatcaaatcctatgagcgcttcaaaaatagtacttggagagaagctc
ttttttgatgttaatttatcaaaaaatagacaaacaagctgttctacatgtcactctttt
gatagagatctaaaaaatagaggtgcaatgtcaaagatgataaattcacctaaagagcag
acgaataactgcgttgcatgtcatctaagagatcaaagcggagtcgatagatttaccttc
tctcaaggggataatcaagagccacacccaaatcttttaaatacgcagagtattttaaat
acggctttttcaaaacattttacatggagtggcgaggtaagtagtttaaggcagcagagc
gaaaactcttttttagcatatcacaagatgaatataacagcggatgaactggtgttaaga
gttggtaaaagtgaaaaatacagagcgatgtttagcactgcttttcaagacgatataaca
tttgaaaatatcaacaaagccattgaggtttatgtaaaaactctagtaactagaggtgcg
tatgacagatttttggatggcgataactctgctataagcagtgacgcaaaaagaggtttg
gcaaacttcatcggttttggctgcaaagggtgtcatagtgatatttcgcttggcggacag
agtattcagagatttccgcttagagattttgcacaagtttatgacttaaaaccaaacttt
gaactttttccagagtttaaaaggtttgatggcgagtttccatttgagaatagtggtgga
tttttaggcaaaaacaaagagcatctctttcgtgttccaattttgagaaatgttactaaa
acatccccttattttcataacggagcagtaccaaagataagagaggcggtaaatgttatg
gcaaagcatcagctaggacgacatttaactcttgagcagattgatgagatagttgcattt
ttaagaacgctagagggcgatattatagagtatgagataagagagaacagatga

DBGET integrated database retrieval system