KEGG   Sulfurimonas denitrificans: Suden_1684Help
Entry
Suden_1684        CDS       T00298                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00330  Arginine and proline metabolism
tdn00332  Carbapenem biosynthesis
tdn01100  Metabolic pathways
tdn01130  Biosynthesis of antibiotics
tdn01230  Biosynthesis of amino acids
Module
tdn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Suden_1684
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Suden_1684
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Suden_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABB44961
UniProt: Q30PX0
Position
1764788..1765555
Genome map
AA seq 255 aa AA seqDB search
MNRIVIKVGTAVLTQDNNIAKERMLNLVTLIAKLRERYDVVLVTSGAVAAGYSALKLDKR
KQIGKKALAAAGQPILMTAYKKKFDIYDITTAQILLTEDDFDSRKRTKMFQEIIDAHLEN
GILPIVNENDITSTPEQLFGDNDQLSANVAHAVESELLVILSDIDGYYDKNPQEFKDAKI
YKVVNEIPQNLLADISTPNNEFATGGIVTKLKAADFLIKNGRKMFLCNGFNLSAAESYLL
EGKHILGTLFEPKKS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattgttataaaagttggaacggcagttttaacgcaggacaataatattgcc
aaggagcgtatgctcaatcttgtaacattgattgccaaactaagagagaggtatgatgta
gttttggtgacatcaggagcggtcgctgctgggtactccgcacttaaattagataaaaga
aaacagattggaaaaaaagctttagcagcggctggtcagcctattctaatgacggcttat
aaaaagaaatttgatatttatgatatcacaacggcacaaattttactcacagaggatgat
tttgactcaagaaaaagaacaaaaatgtttcaagagattattgatgctcatttagaaaat
ggtattttgccaattgtaaatgagaatgatataacttctacccctgagcaactctttggc
gataatgatcagctctctgcaaatgttgcgcatgctgttgaatcagagttgctagttatt
cttagtgatattgatggctattatgataaaaatcctcaagagttcaaagatgctaaaatc
tataaagttgtaaatgaaatcccacaaaatctgctagctgatatatcaacaccaaacaat
gagtttgcaactggtgggatagtgacaaaactaaaagctgctgattttttgataaaaaac
ggacgcaaaatgtttttgtgtaatggattcaaccttagcgctgcagagtcgtatttactg
gaaggcaaacatatacttggaactctttttgagccaaaaaagagttga

DBGET integrated database retrieval system