KEGG   Sulfurimonas denitrificans: Suden_1734Help
Entry
Suden_1734        CDS       T00298                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00051  Fructose and mannose metabolism
tdn00520  Amino sugar and nucleotide sugar metabolism
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Suden_1734
   00520 Amino sugar and nucleotide sugar metabolism
    Suden_1734
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Suden_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABB45008
UniProt: Q30PS3
Position
complement(1818986..1820353)
Genome map
AA seq 455 aa AA seqDB search
MINIILCGGNGTRLWPISRTLMPKQFVKLFDDKSLFQLTVQRNSKICDSQFIVSNAQQYF
LASDQLQELKKSNNKYLLEPLGRNTAPAIALACMALDSEDIVLVTPSDHLIKNESEYDKV
TKEAKILAQSGNLVTFGIKPSFAQTGFGYIEANGNDVKAFHEKPDFSTASKYLGAGNYYW
NSGMFCFKAGVFLDELKKHSPQIYEASKRALQNAKIQNLIRIDYDDMLAIPEDSIDYAVM
EKSSKVKVVPSDIDWSDVGSFDALYEELPKDENGNTINKNYVQIDSKNNLIYGNERKIAT
VDIEDLIIVDTGDALLISKKGASQKVKEIVQKVRGDSELHNIHLTAHRPWGTYTILEDNP
KYKIKRIEVKPGGRLSLQKHFHRSEHWTVVSGTAVVTLGEREIPLRANESIYIPMGELHR
LENAGKLPLVIIETQIGDYLGEDDIVRVKDDYKRS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
ttgataaatataatattatgcggtggaaatggcacaagactttggccaataagcagaaca
ctaatgccaaaacagtttgtaaaactttttgatgataaatcactatttcaactaacagta
cagagaaactctaagatatgcgattctcagtttatagtctcaaatgctcaacaatatttt
ttagcttcagaccagctccaagaacttaaaaaatcaaataacaagtatctactagagcct
ctaggcagaaacactgctccagctattgctcttgcttgtatggcgctagatagtgaggat
atagttctcgttaccccctccgatcatctgattaaaaatgagagtgagtatgacaaagta
accaaagaagcaaaaatcttagctcaatctggcaatcttgtcacatttggcataaaacca
tcctttgcccaaacaggatttggctatatagaagccaatggcaatgatgtaaaagccttt
catgaaaaaccagatttctctactgcctcaaagtatcttggagcaggaaactactactgg
aacagcgggatgttctgctttaaagctggagtttttttggatgaactaaaaaagcactcc
cctcaaatttacgaagcatcaaagagagcactgcaaaatgccaaaatccaaaatctaata
cgcatagattatgatgatatgttagccatccctgaggattctattgactatgcagttatg
gagaaatcatcaaaagtaaaagtagttccctcagacatagattggtcggatgtaggaagt
tttgacgcactctatgaagagttgccaaaagatgaaaatggtaacaccataaacaaaaat
tatgttcaaatagatagtaaaaataacctcatatatggaaatgagagaaaaatagcaaca
gttgacatagaagacctaatcattgttgacacaggcgatgcactcctcatctcaaaaaaa
ggcgcatctcaaaaagtaaaagagattgtccaaaaggtaagaggcgacagcgaacttcac
aatattcacctaacagctcatcgcccatggggaacatacaccatactagaagataaccca
aagtataagataaaacgcatagaagtaaaaccaggcggcagactatcacttcaaaaacat
tttcacagaagcgagcactggacggtagtaagcggaacagcagtagtaacacttggcgag
agagaaatccctctaagagcaaacgaatccatatatattcccatgggtgagttgcaccgc
cttgaaaatgcaggaaaactcccgcttgttatcatagagactcaaataggtgactattta
ggcgaagatgatattgtaagggtaaaagatgattataaaaggtcataa

DBGET integrated database retrieval system