KEGG   Taylorella equigenitalis ATCC 35865: KUI_0095
Entry
KUI_0095          CDS       T02186                                 

Definition
(GenBank) ImpE-like protein
  KO
K11898  type VI secretion system protein ImpE
Organism
tea  Taylorella equigenitalis ATCC 35865
Brite
KEGG Orthology (KO) [BR:tea00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tea02044]
    KUI_0095
Secretion system [BR:tea02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   KUI_0095
SSDB
Motif
Pfam: ImpE TPR_19 TPR_17 P53_C
Other DBs
NCBI-ProteinID: AFN35199
Position
102505..103338
AA seq 277 aa
MNTAGIFKTNSIDEVIEQTKDKVRKNPDSADLRANLFQLLALKGDWTRAVDSLKLSAEMN
SQAQPVAMLYVAAVNAEVDRQNVFQGNGRPAIFGDADEWMGYLIASIEEKDPSKSEELLD
KAMELAPEVSGTIKTRNGEEVNFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIESLRIIE
PSGISDLIWSQAELVLTNGRSIVGMVPNRYPGDYASLDDKFNLGHRTEWVPLFESEESEY
YKGVGQKTYISDLGDHPILEIESIKFNPVLTQDDAES
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaacacagctggtatttttaaaacaaattctattgatgaagttattgagcaaaccaag
gataaagttcgtaagaatccagacagtgcggatttgcgtgcaaatttatttcagctttta
gcacttaaaggggattggactagagctgttgattctctgaaactaagtgctgagatgaat
tcgcaagcacaacccgttgccatgctttatgtagccgctgttaatgctgaggttgacagg
caaaacgtcttccagggtaatggcagacctgctatttttggtgatgctgacgagtggatg
gggtatctaattgcctctattgaggaaaaggatccatctaaatctgaagaattgttagat
aaagctatggaacttgctcctgaagtatcaggaactattaagactagaaacggtgaagaa
gttaattttgaatggctagcagacggagatagccgcctaggtcctatgttggaatttcta
aataatggtcaatatggttgggtaccatttaatgaaatcgaatcgcttcgtatcattgaa
ccttcaggtatctctgatttaatatggtctcaggctgaattagttcttactaacggaaga
tctatagtaggcatggtgcctaatcgttatcctggtgattatgcttcactagatgataaa
ttcaatctaggacatcgtacagagtgggtaccactttttgaatcagaagaatcagaatac
tataaaggtgtaggtcaaaagacatacatttctgatttgggcgatcacccaattttagaa
attgaatctattaaatttaatccagttttaactcaggatgatgcggaaagctga

DBGET integrated database retrieval system