KEGG   Taylorella equigenitalis ATCC 35865: KUI_0096
Entry
KUI_0096          CDS       T02186                                 

Definition
(GenBank) lysozyme-like protein
  KO
K11897  type VI secretion system protein ImpF
Organism
tea  Taylorella equigenitalis ATCC 35865
Brite
KEGG Orthology (KO) [BR:tea00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tea02044]
    KUI_0096
Secretion system [BR:tea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KUI_0096
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFN35200
Position
103349..103912
AA seq 187 aa
MITAHQKRKLDSISRKSDQDYKDKLQPVLLDKLTDEHPERRKELREAATVINFEQLKKSV
LRDLGWLLNTVNLESIESLDGYNHVKSSTINFGVFPVAGQKMSEINHIEIQNQVRNAIIN
FEPRILPNDLEVICELEESDLEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIK
DEGRGSL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgattacagctcatcaaaaaagaaaactcgatagcatctctagaaaaagcgatcaggat
tacaaagataaacttcagcctgtattgcttgataaacttactgacgagcatccagaaaga
cgaaaagaactcagggaagctgctacagttattaattttgaacaactaaaaaagtccgta
cttagagatttaggttggttgctaaacactgttaatttagaatctattgagtctttggac
ggatataatcacgttaaaagttcaactataaattttggcgttttccctgtagctggtcag
aaaatgtcagaaatcaatcatattgaaattcagaatcaagtaagaaacgcaataattaat
tttgagcctagaattttacctaatgatcttgaagttatctgtgaattagaagagtcagat
ttagaacactacaacgtgttgtctcttataatcaagggcagattatggtgtaaccctcat
cctatggagttttttctacgtacctcagttgacttagagtcaggtcacatggagattaag
gacgaaggtagaggatccttataa

DBGET integrated database retrieval system