KEGG   Taylorella equigenitalis ATCC 35865: KUI_0111Help
Entry
KUI_0111          CDS       T02186                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tea00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KUI_0111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tea02044]
    KUI_0111
Secretion system [BR:tea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KUI_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Nsp3_PL2pro
Motif
Other DBs
NCBI-ProteinID: AFN35213
Position
117344..118897
Genome map
AA seq 517 aa AA seqDB search
MADRHAIAHVAIPSLQFLSLNGHESLSNLYEFEVELASMDHFIDVRKMLGTQLTVEIESF
MSAPRYLTGRVRKFELVGTDQDGSEYLVYKASVVPPLWYLTQGKDYKIFQDKKIEDIIKE
VLDKFEIKYEFKLSGSYRNWEYVVQYDESPFNFVSRLMEHEGMYYWFKHDKNESTMIIAD
DASAHEEFPSYEVLNYLSSGFKIFDSREVITSWRHNAVVTPSKYTVVDFDFRKPSFALDT
DKENQLDGDDSIEVYEWQGGYQELSDGDNYTKLRLEELKVPQEIVEADSNIRGICPGYKF
TLANHPRVAENQGYVVVSAHYMIQVNGYSSNSGRQDFFSTSFYSLPASIQFRAARRSPEP
KTHGPQTATVVGPSGEVIYTDKYGRVKVQFHWDRDGKKDENSSCWVRVSSPWASTGFGGL
QIPRIGDEVVIDFIGGNPDRPLIIGRVYNEDNQPLVNLPDDSHTSGFRTRTIQGGSDNQN
FLLFRDKQGDELVDIQAEKDMKIFVKNDFYLTVGNCG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgtcacgcaatcgcacatgtagcgatacctagtcttcagtttttaagtctt
aacgggcatgaatccctttcaaatttgtatgaatttgaagttgaacttgcttcaatggat
cattttattgacgttagaaaaatgcttggaactcagcttaccgttgagattgagtctttt
atgtcggctcctaggtatttaactggtcgtgtacgtaaatttgaactagtaggtactgat
caagatggttctgaatatttagtttacaaagcaagtgttgtgccacctctatggtaccta
acccaaggtaaagattataaaattttccaagataaaaaaattgaagacataatcaaagaa
gtattagacaaatttgaaattaaatatgaatttaaactttcaggttcgtatagaaattgg
gaatacgtagttcaatatgatgaatcaccgttcaatttcgtttcaaggttaatggaacat
gaagggatgtattactggtttaagcatgataaaaatgaatcgactatgattatcgctgat
gatgcttccgctcacgaagaattcccttcttatgaggttcttaattatttgtcatctgga
tttaagatatttgattctagagaggttattacttcatggaggcataatgctgtagtaaca
ccttctaaatatacagttgtagattttgattttagaaagccaagttttgcattagatacc
gataaagaaaaccaattagatggtgatgatagtattgaagtttatgagtggcaagggggg
tatcaggaattatccgacggagacaattatactaaattaagactcgaggaattgaaagtt
cctcaggagattgtagaagcggattcaaacataagaggaatttgtccaggatataaattc
actctggcaaatcatcctagagttgctgaaaatcaaggttatgttgttgtcagtgctcac
tatatgattcaagtaaatggatattcctccaattctggcagacaagatttctttagtact
agtttctattctttaccagcatctattcaatttcgtgctgcacgaagatctcctgagcct
aaaactcatggtccgcaaactgctacagtggtaggtccatctggagaagttatttacact
gacaaatatggtagggttaaagtgcaattccattgggatcgtgatggtaaaaaagatgag
aactcttcatgttgggttcgtgtatcaagtccttgggctagtactggttttggtggttta
caaattcctcgtattggagatgaagttgttattgattttattggtggtaacccagataga
ccattaattatcggcagggtttataacgaggataaccagcctttagttaatctaccagat
gattctcatacctcaggcttccgcacaagaacaattcaaggtggtagcgacaatcaaaat
ttccttttgtttagagacaaacaaggagatgaattggttgacattcaagcagaaaaagat
atgaagatatttgttaagaatgacttttacttaacagttggtaattgcggttaa

DBGET integrated database retrieval system