KEGG   Taylorella equigenitalis ATCC 35865: KUI_0311Help
Entry
KUI_0311          CDS       T02186                                 

Definition
(GenBank) putative polar amino acid ABC transporter, inner membrane subunit
  KO
K10016  histidine transport system permease protein
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tea00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KUI_0311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tea02000]
    KUI_0311
Transporters [BR:tea02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    KUI_0311
   Histidine transporter
    KUI_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFN35406
Position
complement(310106..310810)
Genome map
AA seq 234 aa AA seqDB search
MSDFDVFLDYLPRVLEGALVTLEVALLSVILAVVIGFIGALFRLSKNRIISFIGTFYSTF
VRGVPDIVWMLMIFYSIQIGLNQVTEYFDWDYIEISPFFAGVLTLSFIYGAFFTETFRGA
ILAIPKGSIEAGEAYGMSKMQVSSRIIFPLMMRFAIPGMKNNWLVLNKATALVSLIGLED
MTLIAHNAGSATHLSFAFNLLSALIFLIASWLSLSLFKYLEVHYSRGVLKGVEV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgatgtttttcttgattatttacccagagttctagaaggagctttagtc
actctagaagtcgcactactctctgtcatactggcagttgtaattggctttataggggcc
ttatttagactttcaaagaatcgcattattagttttataggcactttctattctaccttt
gtacgtggagtaccagatatagtctggatgctcatgattttttatagcatccagataggt
ctaaatcaagtaacagaatattttgattgggattatattgagattagtccattttttgca
ggtgttctaactctaagttttatttatggtgctttttttactgaaacatttaggggtgct
attttagctataccaaaagggtctatcgaagctggagaagcctacggtatgagtaagatg
caagtatcttctcgcatcatatttccacttatgatgcgttttgcaattcctggcatgaaa
aacaattggttagtattaaataaagctactgctttagtgtccttgattggtcttgaggat
atgactttaattgcacataatgcgggttctgctactcatttatcttttgcatttaatctg
ctttctgccctaattttcctaatagcatcttggctttcgttgagtctatttaaatattta
gaggttcattattcaagaggtgtacttaaaggagtagaggtttaa

DBGET integrated database retrieval system