KEGG   Taylorella equigenitalis ATCC 35865: KUI_0331Help
Entry
KUI_0331          CDS       T02186                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00450  Selenocompound metabolism
tea00970  Aminoacyl-tRNA biosynthesis
tea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KUI_0331 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KUI_0331 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tea01007]
    KUI_0331 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tea03016]
    KUI_0331 (metG)
Enzymes [BR:tea01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KUI_0331 (metG)
Amino acid related enzymes [BR:tea01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KUI_0331 (metG)
Transfer RNA biogenesis [BR:tea03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KUI_0331 (metG)
 Prokaryotic type
   Other AARSs
    KUI_0331 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f GrpE
Motif
Other DBs
NCBI-ProteinID: AFN35425
Position
complement(324164..326245)
Genome map
AA seq 693 aa AA seqDB search
MARTIFATTALPYANGSFHIGHIMEFIQADIWVRAMRMFGHKVYFMGADDAHGAPIMLKA
QAEGITPEELVSRIASERPQYLNGFQIKHDFWHSTHSTENIEVSQNIYKALKKNGFISTK
TIEQFFDPIKGMFLPDRYIKGECPKCHAKDQYGDSCEVCGAVYAPTDLIEPYSTLTKASP
ELRTSEHFFFNLSDPRCIQFLHDWTNNSGNLNKTHLQGEVLAKTKEWLGDSESDSKLGDW
DISRDAPYFGIPIPDEKDKYFYVWLDAPAGYLAALKAYTKKEGLDYDSIVDPKGETSQIH
FIGKDIIYFHALFWPAMLKFSDRKVPDRIQVHGFITVKGEKMSKSRGTGISPLKYLSVGL
NPAYLRYYIAAKLSAKVEDVDFTAEDFMVRVNSDLVGKYVNIASRASTFINRFFDGHLSF
KTEEQFEEIKKLTDEVKADIENFEYSKAVRAIMAFADKVNTAFDQAKPWVLAKGFSEASD
ETKAQLQDICSQAIAGFKAICTLLYPITPELSTSIYEDLFDIKKDLVWDDAYEKPLFIKP
FKHLLQRVEEKQLDELFEPTTDQKVTESEEKLIPGGQAIADTITIDDFSKVDMRVAKIVD
CKKVEGSTKLLQLTLDVGEGRNRNVFSGIQSAYEPEDLIGKLTVVVANLAPRKMKFGVSE
GMVLSAAHADREAVPGLWILEPQSGAQPGMRIG
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcactatattcgccacaactgcccttccatacgcaaatggttcgtttcatatc
ggacatatcatggagtttattcaagctgatatttgggttagagccatgcgtatgtttggg
cataaggtttatttcatgggggcggacgatgctcatggagcacccatcatgcttaaggct
caagctgagggcatcactcctgaagaattagtatcacgtatagcaagcgagagaccacaa
tatttaaacgggtttcaaattaagcatgacttctggcatagtactcatagcacagaaaat
atcgaagtttcacaaaacatatacaaagctctaaagaaaaatggatttatttctactaaa
accatagagcaattctttgaccctataaaggggatgtttcttcctgatcgatatatcaaa
ggcgaatgccctaagtgtcatgcaaaagatcagtatggagattcatgcgaagtttgtggg
gcagtttacgcacctacggatttaattgagccttactctactcttacaaaggctagtcct
gaacttagaacctctgagcatttcttttttaatttatctgacccaagatgtatacaattc
cttcacgattggacaaacaattcaggtaatctaaataaaacacatctccaaggtgaagtc
ttagccaaaacaaaagaatggttaggtgattcggaaagtgatagcaaattaggggattgg
gatatctctagagatgcaccatatttcggcatacctatcccagatgaaaaagataagtat
ttttatgtttggcttgatgctcctgctggctatttagctgcattaaaagcctatactaaa
aaagaaggtttggattacgattctattgtcgatccaaagggagaaacttctcaaatccac
tttatcggaaaagacattatttattttcatgctttgttttggcctgccatgcttaagttc
tccgatagaaaagttccagatcgcatacaggttcacggatttataactgttaaaggcgaa
aagatgtccaaaagccgaggtacaggtatctctccacttaagtacttaagtgtagggtta
aatccagcatatcttagatactatatcgctgctaaattaagtgctaaagttgaagacgtg
gattttacagctgaggattttatggtccgtgtaaattcagatttagtaggcaagtacgta
aacattgccagccgtgctagtacatttataaatcgcttttttgatggtcatttatctttt
aaaactgaagagcaatttgaggaaatcaaaaaacttacagatgaagtcaaagctgacatt
gagaattttgaatattctaaagctgttagagccattatggctttcgcagataaagtaaac
actgcgttcgatcaggctaaaccctgggttcttgctaaaggattctctgaagcttcagat
gaaaccaaggcacaattacaggatatttgctcgcaggcgattgctgggtttaaagctatc
tgcacactgctttaccctattactcccgaattaagcacctctatttacgaggatttattt
gatatcaaaaaagatttggtttgggatgatgcctatgagaaacctctatttatcaaacca
ttcaagcatttacttcaaagagttgaggaaaaacaattggacgaattatttgaacctact
acagatcaaaaagtgactgaaagtgaagagaaacttattcctggaggacaggctattgca
gacacaataactattgatgatttttcaaaagttgatatgcgtgtagcgaaaattgtggac
tgcaaaaaagttgagggttcaactaaattactacaacttacattggacgtgggcgaaggt
agaaatcgtaatgtgttctctggcattcaatcagcttatgaaccagaagatcttatcggc
aaactaactgttgttgtagctaatcttgctcctagaaaaatgaaatttggagtttctgaa
ggtatggtgttgtctgctgctcatgctgacagagaggcggttccaggactatggatttta
gaaccacagtcaggagctcagccaggcatgcgtatcggttga

DBGET integrated database retrieval system