KEGG   Taylorella equigenitalis ATCC 35865: KUI_0395Help
Entry
KUI_0395          CDS       T02186                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea00250  Alanine, aspartate and glutamate metabolism
tea00330  Arginine and proline metabolism
tea01100  Metabolic pathways
tea01110  Biosynthesis of secondary metabolites
tea01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KUI_0395
   00330 Arginine and proline metabolism
    KUI_0395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tea03000]
    KUI_0395
Enzymes [BR:tea01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     KUI_0395
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     KUI_0395
Transcription factors [BR:tea03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    KUI_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AFN35487
Position
411301..415077
Genome map
AA seq 1258 aa AA seqDB search
MSSTTPEVRVESSTKPFQQFASSVLSQSDLRAAITAAYRRPETECLPPLLELANPGELRS
AIADTARDLVTKLREKRTGGGVDGLIHEYSLSSEEGIALMCLAEALLRIPDNHTRDALIK
DKIAKGDWKSHLGSSSSMFVNAVTWGLMITGKLVRPQKEASLSASLTKLIARGGEPLIRK
GVDQAMHIMGEHFVRGETIEKALSNGKSMIEKGFNYSFDMLGEAAMTDEDALRYYKAYED
SIHAIGKAATGRDVYEKSGISIKLSALHARYSRSQIDRVMEELYPRLRDLTFLAHKYDIG
INIDAEEADRLEISLDLLEKLCHEPQLAGWKGIGFVVQAYSKRTPFVIDWLIDLARRTNR
RLMIRLVKGAYWDTEIKRAQVDGLDGYPLYTRKFHTDVSYLACARKLLAAKDEIFPQFAS
HNAQTLASIYHMAGPDFYHGKFEFQCLHGMGEPLYEEVVGDVKDGKLGRPCRIYAPVGTH
ETLLAYLVRRLLENGANSSFVNRITDENVSIDDLIVNPVDEALAVSPVGSPHEMIPLPRD
LYKAQGQDRLNSRGIDLSNEQRLRKLADGLTEATSKEWVSMPTGLESVATDSSRAHETKN
PADHSDTIGRVAFATKSEAEQMVTKAETAFASWSSLSASDRAGMLQKAADIIESKDEFFI
ALAVREAGKSFSNAVAEIREAVDFLRYYSYQVETKLSNPQNKPLGPVVCISPWNFPLAIF
MGQISAALSVGNVVLAKPAEQTPLIAYYAVEALHEAGIPKDVVQLVPGAGDIGAALVADE
RVKGVMFTGSTAVAQSIAKVLSNRSVSDGKPIPLIAETGGLNAMIVDSSALAEQVVVDVV
SSAFDSAGQRCSALRILCVQEDVADSLLTMLKGNMDELKVGNPDRLSTDVGPVIDAEAQK
NILDHIEHMRSEGFKIHQTKMDDSVIKGTFVAPTLIEVNDVTDVKKEVFGPVLHVVRFNR
RNLNELIDKINLSGYGLTFGMHSRINESVDDVSSRVKAGNLYINRNIIGAVVGVQPFGGM
GLSGTGPKAGGPLYQYRLLAEGGHDCVRDVLSSDPLSAKLKMPTPTGEENFYFVRPRGNV
LCLAQTATGARAQLEACSITGNNALFAGWPDLQSLNSEVVAVVGRADSNNSTNTLNSSKT
SNPSKSPKSSDASKSTNATAQRGISIYKNSNPSVSANIATLLSTYRVDAVLVEGDAQELK
QIAKEFAQNSAIVIQPQALSTSAIESGAKYDLERLLVEQSLSVNTAAAGGNATLMAVV
NT seq 3777 nt NT seq  +upstreamnt  +downstreamnt
ttgagttccaccacaccagaagttagagtagagagcagtacaaagccatttcagcagttt
gcaagttctgtattgagccaatctgacttaagagccgcaattacggccgcttacagaaga
cctgaaacagagtgtcttccaccattattagaacttgccaacccaggcgaacttagatcc
gcaattgcagatactgcaagagacttagtaaccaagctacgcgagaagcgaacgggtggt
ggtgttgatggtttaattcatgaatattccttaagtagtgaggaaggtattgccctcatg
tgcttggctgaagctcttcttcgcataccagataatcacacacgtgatgccttaataaaa
gataagattgcaaaaggtgactggaaatcacatctaggctcaagtagttcgatgtttgtt
aatgccgtgacttggggacttatgattactggaaaactagtacgtccacaaaaagaagca
tcactttcagcatctttaactaaactgatagcacgtggtggagagcccctaattcgtaag
ggtgtagatcaagcgatgcacattatgggtgagcattttgttcgtggtgagaccattgaa
aaagccctttcaaacggcaaatccatgattgaaaagggttttaactattctttcgatatg
ttgggtgaggctgcgatgaccgatgaggatgcattgcgttattacaaagcatatgaagac
tcaatccatgcgataggaaaggctgcgactggtcgtgatgtctacgagaaatcaggtatc
tcaattaaattgtctgcattgcatgctagatattctcgctctcaaattgaccgtgttatg
gaagagctctatccacgtctaagagaccttacattcctagctcataaatacgatataggt
attaatatcgatgcggaagaggcggatcgcttagaaatatccctagatttattagaaaaa
ttatgtcatgaaccccaacttgcaggttggaagggcatagggtttgtagttcaagcatac
tcaaaaagaacgccatttgttatagattggttaattgatttagcccgtcgcaccaatcgt
cgtttgatgattcgtctagtgaaaggtgcatattgggatactgaaataaaacgtgcacaa
gtcgatggtctagacggatatccactttatactcgtaaattccataccgacgtgtcctac
cttgcatgcgctagaaaattgctagcagctaaagatgaaattttccctcaatttgcctca
cataatgctcagacactagcctcaatctaccatatggcaggacctgatttctatcatggt
aagtttgaatttcaatgcttgcatgggatgggcgaacctctatacgaagaagttgttggt
gacgtaaaagatggaaaattaggtcgtccttgcaggatttatgctccagttggtacacat
gagacattgcttgcatatttagttcgtcgtctgttagaaaacggggctaattcttcattc
gtaaatcgcatcaccgacgaaaatgtctctatcgacgatttgattgtaaatccagtagat
gaggcacttgccgtgagtccagttgggtctccgcatgaaatgattccattgccacgagat
ttatataaagctcaaggtcaggataggctcaattctcgtggtatcgacctctcaaatgaa
caacgtttacgtaaattagcggacgggctgactgaggctactagcaaagaatgggtttct
atgcctactggattggagtctgtagctacggattcgtctcgagcacatgagactaaaaat
ccagctgaccactctgataccattggtagggttgcatttgcgactaagtctgaggccgag
caaatggttactaaagcagaaactgcatttgcaagttggagctctttgagtgcatcggat
agggctggtatgcttcaaaaagcggctgacataatagagtctaaggatgaattttttatc
gcactagctgtccgtgaagcaggcaaaagcttttcaaacgccgtcgcagaaatccgcgaa
gcagtagacttcctgagatattactcatatcaagtagaaacaaagctctcaaatcctcaa
aacaaaccgctaggtccagttgtttgcattagcccttggaatttcccattggccatattt
atggggcagatatcagcagctctttctgttggcaatgtagtcttagctaaaccagcagag
caaacaccactgattgcttattatgccgtagaagctttgcacgaggcaggtattcctaag
gacgttgtgcaacttgtgcctggtgcgggtgatattggtgcagcattagtagcagatgaa
cgtgtaaaaggggttatgtttactggctcgacggctgtagcacaaagcattgccaaagtg
ctttcaaataggtctgtgtcagacggtaagcctataccacttatcgccgaaactggtggt
cttaacgcaatgattgtggactcctccgctttagctgagcaagttgttgtcgatgtagtg
tcttcagcatttgattctgcaggtcagagatgctcagcccttcgcatattatgtgttcaa
gaggatgttgcagattcgcttcttactatgcttaagggaaatatggatgaactgaaggta
ggtaatccagatagactttctacagatgttggtccagtaattgatgcagaggctcagaaa
aacatacttgaccatattgagcacatgcgttctgaaggctttaagatccatcaaactaag
atggacgactcagtaataaaaggtacattcgtagctccaacattaattgaagttaacgat
gttaccgacgtcaaaaaagaagtattcgggccagttcttcatgtcgttagatttaataga
cgtaacctaaatgagcttattgacaaaataaacttaagtggctatggactgacatttggc
atgcattctcgcattaacgaatctgtagatgatgtctctagccgtgtgaaagcaggtaat
ctttatatcaacagaaatattatcggtgcagttgtgggtgtacaaccttttggaggcatg
ggactttcaggtactggtcctaaagctggtggacctctgtatcagtacaggttattagca
gaaggggggcatgattgcgttagagatgtgctttcaagcgatccattatccgcaaaacta
aaaatgccgactcctacaggcgaggagaacttttatttcgtacgccctcgtggtaatgtt
ttatgtcttgcacagactgctactggagcacgggctcaattagaagcatgctcaataact
ggtaataacgccttgtttgcgggatggccagatttacaaagcttaaattcagaggtcgtt
gcagttgttggtagagctgattctaataactctacgaatactttgaattcatcaaaaact
tctaatccttcgaagtctcctaaatcttcagatgcatctaaatcaactaatgctactgct
caacgaggcattagtatttataaaaattctaatcctagcgtgtcagcaaacattgccaca
ttgctatcaacatatagagtggatgcggtgcttgtagaaggagacgctcaggaattgaag
cagatcgcaaaagaattcgcacaaaacagtgccatcgtaattcaaccgcaagccctgagt
acatctgcgattgaaagtggtgcgaagtacgatcttgagcgacttttagtggaacagtct
ttaagcgtaaatactgccgctgcagggggtaatgcgacattaatggctgtagtttaa

DBGET integrated database retrieval system