KEGG   Taylorella equigenitalis ATCC 35865: KUI_1549Help
Entry
KUI_1549          CDS       T02186                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tea  Taylorella equigenitalis ATCC 35865
Pathway
tea03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tea00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KUI_1549 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tea03011]
    KUI_1549 (rplV)
Ribosome [BR:tea03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KUI_1549 (rplV)
  Bacteria
    KUI_1549 (rplV)
  Archaea
    KUI_1549 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10 DUF1967
Motif
Other DBs
NCBI-ProteinID: AFN36591
Position
complement(1677504..1677842)
Genome map
AA seq 112 aa AA seqDB search
MEVTSIVRGVHISAQKTRLVADLIRGKKVDQALHILNFTQKKAAGILKKALESAIANAEH
NNGADIDELTVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKVGTKEQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaagttacatcaatagtacgtggagtacatatatcagctcaaaaaactagacttgtt
gcagatttaatccgtggcaaaaaagttgatcaagctttgcatatcttaaacttcactcag
aaaaaagctgctggcattcttaagaaagctcttgaatctgccatcgcaaatgctgagcac
aataatggtgcagatatcgacgaacttacagtaactactatattcgtggataaagcacag
tctatgaagcgtttctccgcacgcgctaaaggtcgcggcaaccgcattgaaaagcaaact
tgccatattacggtcaaagttggcactaaggagcaataa

DBGET integrated database retrieval system