KEGG   Candidatus Tenderia electrophaga: Tel_04685Help
Entry
Tel_04685         CDS       T04171                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00450  Selenocompound metabolism
tee00970  Aminoacyl-tRNA biosynthesis
tee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tel_04685
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tel_04685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tee01007]
    Tel_04685
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tee03016]
    Tel_04685
Enzymes [BR:tee01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Tel_04685
Amino acid related enzymes [BR:tee01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Tel_04685
Transfer RNA biogenesis [BR:tee03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tel_04685
 Prokaryotic type
   Other AARSs
    Tel_04685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ALP52499
UniProt: A0A0S2TBN1
Position
complement(1005824..1007899)
Genome map
AA seq 691 aa AA seqDB search
MSASPRKILVTSALPYANGSIHLGHLVEYIQTDIWARFQRMSGNECHYVCADDTHGTPIM
LRAQQEGITPEALIERVHGEHLADFSAFHIAFDNYYSTNSEENRELAQAIYRRLKAKGLI
EIRTIEQLYDPQKEMFLPDRFIKGKCPKCGAEDQYGDSCEVCGATYAPTDLIDPYSALSG
AKPVLKESEHHFFKLGECEAFLKQWLMENPDQAPLQAESANKLSEWFEAGLKDWDISRDA
PYFGFEIPDAPGKYFYVWLDAPIGYMASFKNLCDRKGIDFDAYWKPDSDAEVYHFIGKDI
LYFHALFWPATLKFADYRTPTRICVHGFLTVNGQKMSKSRGTFIMASSYLNHLKPEYLRY
YFAAKLSDRVEDIDLNLEDFVSRVNSNLVGKYVNIAARSAGFIKKRFDNRLSAELDDAGR
QLLESIQSKQAAIAARYEKRQFSEAMREIMALADIANEYVDETKPWVLAKEDGQNDTLQR
ICTATVNAFRLLTIYLKPVLPQLAEQVEAFLKIEPLRWGDSQTLLLDHAIEPYQHLATRI
DPQQIEAMLAESTESLKKAAHSPARHGEAQQQQEEKMTEAMSDTIEYDDFAKVDLRIARI
VKAEHVEGADKLLQLTLDIGEENTRNVFAGIKSAYSPEQLAGKLTVMVANLAPRKMRFGV
SEGMVLAAGPGGRELWILEPHEGAQPGMKVK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaagccccagaaaaatcctcgtcaccagcgccctgccctatgccaacggttcc
attcatctaggccacttggtcgaatacatccagaccgatatctgggcccgtttccaacgc
atgtcgggcaatgaatgccattatgtctgcgccgacgatacccacggcacccccatcatg
ctgcgcgcccaacaggagggcatcacccccgaggcgctgatcgaacgcgtgcatggcgaa
cacctggctgacttcagcgctttccacatcgccttcgacaactactactccaccaactcg
gaggaaaaccgcgagctggcgcaggcgatctaccgccgcctcaaggccaagggcctgatc
gagatccgcaccatcgaacagctctacgacccgcaaaaagaaatgttcctgccggaccgt
ttcatcaagggcaagtgccccaaatgcggggccgaggatcagtacggcgattcctgcgaa
gtgtgcggcgccacctacgcgccgaccgatctcatcgatccctactcggccctgtccggt
gccaagccggtactcaaggaatcggaacaccacttcttcaaactgggcgagtgtgaagct
tttctcaagcagtggctgatggaaaatcccgaccaagcgccgctgcaggccgaatcggcc
aacaagctcagcgagtggttcgaggccggcctgaaggactgggacatctcccgcgatgcc
ccctatttcggcttcgagatcccggacgcgccgggcaaatatttttatgtctggctcgac
gcgcccatcggctacatggccagcttcaagaatctgtgcgacaggaaaggcatcgatttc
gacgcctattggaaacccgattccgacgccgaggtgtatcacttcatcggcaaggacatc
ctctacttccacgccctgttctggccggcgaccctgaagttcgccgactaccgcaccccg
acgcgcatctgcgtgcatggctttctgaccgtcaacggccagaaaatgtccaagtcgcgc
ggcaccttcatcatggcaagcagctatctgaatcatctcaagccggaatacctgcgctac
tacttcgccgccaagctcagcgaccgggtggaagacatcgacctcaacctggaggacttc
gtcagccgcgtcaatagcaacctggtgggcaagtacgtcaacatcgccgcacgctcggcc
ggtttcatcaagaagcgtttcgacaaccggctcagcgcagaactggacgacgccggccgt
caattgctggagtctattcagagcaagcaggctgccatcgccgcacgctacgaaaagcgc
cagttcagcgaagccatgcgcgagatcatggccctggccgacatcgccaatgaatacgtg
gacgaaaccaaaccctgggtgctggccaaagaagacgggcagaacgacacgctgcagcgc
atctgcaccgccaccgtcaatgccttccgcctgctgaccatctacctgaaaccggtgttg
ccgcagctggccgaacaggtggaagcctttctcaagatcgaaccgctgcgctggggcgac
agtcaaaccttattgctggaccatgccatcgagccctatcagcatctcgccacccgcatc
gacccgcaacagatcgaggccatgttggccgaaagtacggagagcctgaaaaaggccgca
cactcccccgcccgccacggcgaggcgcaacagcagcaggaagagaagatgaccgaagcc
atgagtgacaccatcgaatacgacgacttcgccaaggtcgacctgcgcatcgcccgcatc
gtcaaggccgaacacgtcgagggtgccgacaagctgctgcagttgaccttggacatcggc
gaggaaaacacccgcaacgtcttcgccggcatcaaatccgcctacagcccggaacagctg
gcgggcaaactgaccgtcatggtggccaacctggcgccacgcaaaatgcgtttcggcgtc
tctgagggcatggtgctggcggccggccccggcggcagggaattgtggattctggaaccc
catgagggcgcccagccgggcatgaaggtgaaatag

DBGET integrated database retrieval system