KEGG   Candidatus Tenderia electrophaga: Tel_05985Help
Entry
Tel_05985         CDS       T04171                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00480  Glutathione metabolism
tee00590  Arachidonic acid metabolism
tee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Tel_05985
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tel_05985
Enzymes [BR:tee01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tel_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALP52737
UniProt: A0A0S2TC47
Position
1283601..1284158
Genome map
AA seq 185 aa AA seqDB search
MKHSSKIFFTWVAGLVLAGTVSAADTVCSEVLDFERKPLAGEGSINLCEHYRGKVIVVVN
TASKCGYTYQYEGLEQLYSRYEAQGLVVLGFPSNDFANQEPGSADQIKTFCRLTYGVKFP
MFAKTRVARGTDDPLFRALARHAGEYPQWNFHKYLIDRQGRVAASYASKVEPLGGELEAA
VKGLL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagcagcaaaatatttttcacctgggtggctggcttggtgttggccggcacg
gtcagtgccgccgatacggtctgttctgaggttctggatttcgagcgtaagccgctggcg
ggcgagggcagtatcaatctttgtgagcactatcggggcaaggtgatcgtggtggtcaac
accgccagtaagtgtgggtacacctatcaatacgagggactggaacagctgtacagccgc
tacgaggcgcagggtctggtggtgctcgggtttccgtccaatgatttcgccaatcaagaa
cccggttcggccgaccagatcaaaaccttttgccgcctgacctacggcgtgaaattcccc
atgtttgccaagacccgcgtcgcgcgcggcaccgatgacccgctgttccgcgccttggcc
cggcatgcgggcgagtacccgcagtggaactttcacaaatacctcatagatcggcaaggc
cgcgtggcggccagttatgccagcaaggtggaacccttgggcggtgaattggaagccgcc
gtcaagggcttgttgtag

DBGET integrated database retrieval system