KEGG   Candidatus Tenderia electrophaga: Tel_15660Help
Entry
Tel_15660         CDS       T04171                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00071  Fatty acid degradation
tee00280  Valine, leucine and isoleucine degradation
tee00310  Lysine degradation
tee00362  Benzoate degradation
tee00380  Tryptophan metabolism
tee00620  Pyruvate metabolism
tee00630  Glyoxylate and dicarboxylate metabolism
tee00640  Propanoate metabolism
tee00650  Butanoate metabolism
tee00900  Terpenoid backbone biosynthesis
tee01100  Metabolic pathways
tee01110  Biosynthesis of secondary metabolites
tee01120  Microbial metabolism in diverse environments
tee01130  Biosynthesis of antibiotics
tee01200  Carbon metabolism
tee01212  Fatty acid metabolism
tee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tel_15660
   00630 Glyoxylate and dicarboxylate metabolism
    Tel_15660
   00640 Propanoate metabolism
    Tel_15660
   00650 Butanoate metabolism
    Tel_15660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tel_15660
   00072 Synthesis and degradation of ketone bodies
    Tel_15660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tel_15660
   00310 Lysine degradation
    Tel_15660
   00380 Tryptophan metabolism
    Tel_15660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tel_15660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tel_15660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tel_15660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tee04147]
    Tel_15660
Enzymes [BR:tee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tel_15660
Exosome [BR:tee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tel_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALP54468
UniProt: A0A0S2TH69
Position
3427529..3428824
Genome map
AA seq 431 aa AA seqDB search
MATRSKGRPVFIVDGARTPFFKAVGKPGPFRASDLAVAAGRPLLARQSFEPENLDEVILG
CVMPGPDEANIGRVVALRLGCGKSVPAWTVQRNCASGMQALDCAYKNIATGRANLILAGG
TESMSHAPVLLNEKMVAWLADWSKAKSFGRKLQLLGQLRGGHLKPVIGLLRGLSDPIVGL
SMGQTAEILAHKFKIDRDTMDAYAVASHHRLAKAQDEGWLDEIEAVYDSRGKHHLHDTGL
RRDSSLASLAKLKPVFDRQFGRVTAGNSAQVTDGAAMLILASEEAVKQYELPVLGRIVDS
EWAGLEPSQMGLGPVHAMTPIMKRKRWKPDGVDYWEINEAFATQVLACLEAWKDEHYCSS
ALNMRTAMGEIDRDRLNVDGGGVSLGHPVGASGARIVLHLLHVLERNNAKRGMASLCIGG
GQGGAMAVERD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacgcagcaaggggagaccggtatttatcgtggacggtgcccgtacgcccttc
ttcaaggcagtgggtaaaccggggccgtttcgggcctccgacctggccgttgcagcggga
cgcccgctgttggcgcgacagtcgttcgaacccgagaacctggacgaggtgatcctgggt
tgcgtcatgcccgggccggacgaggccaacatcggccgcgtcgtggcgctgcgactgggc
tgcggcaaatcggtgcccgcctggacggtgcaacgcaattgcgcctccggcatgcaggcc
ctggactgcgcctacaagaacatcgccaccggccgcgccaacctgatcctggccggcggg
acggaatccatgagtcacgcccccgtgctgctcaatgaaaagatggtggcctggttggcc
gactggtccaaggccaaaagcttcggccggaaattgcagcttctgggtcaactgcgtggc
ggtcatctaaagcccgtcatcggtctgctgcgtggcctgagcgatcctatcgtcggcctc
tccatgggccagacggccgagatcctggcgcacaaattcaagatcgaccgcgacaccatg
gacgcctatgccgtggcgagtcatcaccgcctggccaaggcccaggacgagggttggctg
gacgagatcgaggctgtttatgacagccgcggcaaacatcatctgcacgataccggcctg
cggcgcgactccagcctggccagcctggccaagctgaaaccggtcttcgaccgtcagttc
ggccgcgtcaccgccggcaacagcgctcaggtcaccgacggcgccgccatgctgatcctg
gccagcgaggaggcggtgaagcagtatgagttgccggtactgggacgcatcgtcgacagc
gaatgggccggactggaaccgagccagatggggctggggccggtacacgccatgacccct
atcatgaaacgcaaacgctggaagccggatggcgtggactattgggagatcaacgaggcc
ttcgccacccaggtgctggcctgtctcgaggcctggaaagacgaacactattgcagcagt
gcactgaacatgcgcacggccatgggcgagatcgaccgcgatcgtttgaatgtggacggc
ggcggcgtcagtctggggcatccagtgggtgccagcggcgcgcgcatcgtgttgcatctg
ctgcacgtgctggaacgcaacaacgccaaacgcggcatggccagtctgtgcatcggcggc
ggacagggcggcgccatggccgtggaaagggattaa

DBGET integrated database retrieval system