KEGG   Candidatus Tenderia electrophaga: Tel_15800Help
Entry
Tel_15800         CDS       T04171                                 

Definition
(GenBank) two-component system response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tel_15800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tee02022]
    Tel_15800
Two-component system [BR:tee02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Tel_15800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ALP54494
UniProt: A0A0S2TH77
Position
complement(3454208..3454921)
Genome map
AA seq 237 aa AA seqDB search
MTRYQVLVVDDDPDVCDLIRDYLSDKGYIVSVAHSGTDMRSRLQQATPDLILLDVGLPGE
DGLSLARYAREHLDIAVIMVSGAGEAIDRILGLEVGADDYITKPFDPRELVARIKTVLRR
YQGRGGDGEVATADTNGRVRIGHCSLDMTRYQLFDGQGQEIPMTTMEFELLRTFVEHPNR
PLSRDQILGLTQNRDWSPYDRSIDIRIARLRKKVEPDPENPRVIKTVRGVGYMFIPD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgttaccaggtcttggtggtcgacgatgatcctgatgtgtgcgatctgatccgg
gactatctcagcgacaagggctatatcgtcagcgtcgcccactcgggcacggacatgcgc
agccgcttgcagcaagcgacgcccgacctgatcctgttggatgtgggactgccgggggaa
gacggcctgagcctggcccgttacgcccgcgagcatctggacatcgccgtgatcatggtc
tccggcgcgggcgaggccatcgaccgcatcctgggcctggaggtcggcgccgacgactac
atcaccaagcccttcgatccccgtgaactggtggcgcgcatcaagaccgtgttgcggcgc
tatcaaggccgcggcggtgacggcgaggtcgccactgccgataccaacgggcgcgtgcga
atcgggcactgcagcttggacatgacgcgctatcaactgttcgacggccagggccaggag
atccccatgaccaccatggagttcgagctgttacgcaccttcgtcgaacaccccaaccgc
cccctcagccgcgaccagatcctgggcctgacccagaaccgcgactggtcgccctatgac
cgcagcatcgacatccgcatcgcccggctgcgcaagaaagtggagcccgacccggagaac
ccgcgcgtgatcaagacggtgcgcggtgtcggctatatgttcattcccgactag

DBGET integrated database retrieval system