KEGG   Candidatus Tenderia electrophaga: Tel_16210Help
Entry
Tel_16210         CDS       T04171                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
tee  Candidatus Tenderia electrophaga
Brite
KEGG Orthology (KO) [BR:tee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tel_16210
Enzymes [BR:tee01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Tel_16210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase NTPase_I-T
Motif
Other DBs
NCBI-ProteinID: ALP54570
UniProt: A0A0S2THF6
Position
3545126..3545941
Genome map
AA seq 271 aa AA seqDB search
MNQNRVAAVQMASGPNVNANLLEAGRLIAKAAGEGAGMVVLPENFAIMGVKEQDKVAVRE
QDGHGPIQEFLAQQAARHGIWVVGGTVPMAAQSPSKVLAACLVYNEAGERVARYDKLHLF
DVTLEGGAEKYTESETIEHGKDVVVIDSPFGRMGIAVCYDLRFPEMFRKMLDQDMELLVL
PAAFTAITGKAHWEVLVRARAIENLCYVVAAAQGGYHVNGRETHGDSMVVNPWGVVIDRL
PRGSGVVMGDIDRDQLAAMRRSLPAISHRRL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaatcgtgtagctgcagtgcaaatggcctccgggcccaatgtgaatgccaat
ttgctggaggcgggtcgcctcatcgccaaggccgcgggcgaaggcgccggcatggtggtc
ttgccggaaaacttcgccattatgggcgtcaaggaacaggataaggtggccgtgcgcgaa
caagacggccacgggccgatccaggagtttctggcccagcaggccgcccggcacggcatc
tgggtggtgggtggcaccgtgcccatggcggcccagagcccgagcaaggtgctggccgcc
tgtctggtctataacgaggccggcgagcgggtggcgcgctacgacaagctgcatctgttc
gatgtgactctggaaggcggcgcggaaaaatataccgaatcggagaccatcgaacacggc
aaggacgtggtggtgatcgacagccccttcggccgcatgggcatcgcggtgtgttacgac
ctgcgttttcccgagatgtttcgcaagatgctggatcaggatatggaattattggtcctg
cccgccgccttcaccgccattaccggcaaggcccactgggaggtgctggtgcgcgcccgg
gccatcgagaatctttgttacgtggtggccgccgcccagggcgggtatcacgtcaacggc
cgcgagacccatggcgacagcatggtggtcaacccctggggtgtggtgatcgaccgcctg
ccgcgcggttccggcgtagtcatgggcgacatcgaccgcgaccagctggccgccatgcgc
cgcagcctgccggccatcagtcatcgccgcctgtaa

DBGET integrated database retrieval system