KEGG   Taylorella equigenitalis 14/56: KUK_0333Help
Entry
KUK_0333          CDS       T02604                                 

Definition
(GenBank) putative hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
teg  Taylorella equigenitalis 14/56
Brite
KEGG Orthology (KO) [BR:teg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KUK_0333
Enzymes [BR:teg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     KUK_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase RNase_3_N
Motif
Other DBs
NCBI-ProteinID: CCG17647
UniProt: I7IIP9
Position
369734..370543
Genome map
AA seq 269 aa AA seqDB search
MSVLKVAVGQFPATNDIDLNIKKIKCLYESAAQQNAELIVLPEASMCSFASELEVLKKLA
KEETPRFIEQIKAFSKEFNMYTIVGVLSNSSIEDDSRIENHLLVIDPNGLQIVDYSKIHV
YDAFSFKESDKVRPATLQEDSSHFGIFNIKEFKIGLINCYDLRFPELARSLIELGANVLS
VSANWVTGAFKETHWEILLRARAIENTSYVLASGQTRPKGVGLSMIIDPLGFIINGCGDE
EGVIVSEINSDRLNKVRQLVPCLANRRLT
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtactaaaagttgctgttgggcaatttccagctaccaatgatattgatttaaat
attaaaaaaataaaatgcttatatgagagtgcagctcagcaaaatgctgagttaattgtt
ttgcctgaagcttcaatgtgttcttttgcatctgaattagaggtacttaagaaactagct
aaagaagaaacgcctagatttattgaacagataaaagcattttctaaagaatttaatatg
tacacaattgttggtgtactttctaatagttctatagaagatgactctcgcatagaaaat
catcttctagtaatcgacccaaatggattacaaatagtcgattattcaaaaatccatgtg
tatgatgccttttcatttaaggagtcggacaaggtcagacctgcaacattgcaagaggac
agctctcattttggtatttttaatatcaaagaatttaaaattggactgatcaattgttat
gacttgcgctttccagaattagcccgttcacttattgaattaggagctaacgttctttct
gtaagtgctaactgggtgactggagcatttaaggagactcattgggaaatccttttgaga
gctagggcgatagaaaatacatcttacgttttagcaagcggacaaactagaccaaaaggc
gtaggacttagcatgattattgatccgctgggttttataattaatggatgcggtgatgaa
gaaggtgtcatcgtaagcgagataaattcagatagacttaataaagttagacagctcgta
ccttgtcttgcaaatcgcagacttacataa

DBGET integrated database retrieval system