KEGG   Taylorella equigenitalis 14/56: KUK_0968Help
Entry
KUK_0968          CDS       T02604                                 

Definition
(GenBank) putative polar amino acid ABC transporter, inner membrane subunit
  KO
K10016  histidine transport system permease protein
Organism
teg  Taylorella equigenitalis 14/56
Pathway
teg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:teg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KUK_0968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:teg02000]
    KUK_0968
Transporters [BR:teg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    KUK_0968
   Histidine transporter
    KUK_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CCG18265
UniProt: I7JPW2
Position
1049454..1050158
Genome map
AA seq 234 aa AA seqDB search
MSDFDVFLDYLPRVLEGALVTLEVALLSVILAVVIGFIGALFRLSKNRIISFIGTFYSTF
VRGVPDIVWMLMIFYSIQIGLNQVTEYFDWDYIEISPFFAGILTLSFIYGAFFTETFRGA
ILAIPKGSIEAGEAYGMSKMQVSSRIIFPLMMRFAIPGMKNNWLVLNKATALVSLIGLED
MTLIAHNAGSATHLSFAFNLLSALIFLIASWLSLSLFKYLEVHYSRGVLKGVEV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgatgtttttcttgattatttacccagagttctagaaggagctttagtc
actctagaagtcgcactactctctgtcatactggcagttgtaattggctttataggggcc
ttatttagactttcaaagaatcgcattattagttttataggcactttctattctaccttt
gtacgtggagtaccagatatagtctggatgctcatgattttttatagtatccagataggt
ctaaatcaagtaacagaatattttgattgggattatattgagattagtccattttttgca
ggtattctaactctaagttttatttatggtgctttttttactgaaacatttaggggtgct
attttagctataccaaaagggtctatcgaagctggagaagcctacggtatgagtaagatg
caagtatcttctcgcatcatatttccacttatgatgcgttttgcaattcctggcatgaaa
aacaattggttagtattaaataaagctactgctttagtgtccttgattggtcttgaggat
atgactttaattgcacataatgcgggttctgctactcatttatcttttgcatttaatctg
ctttctgccctaattttcctaatagcatcttggctttcgttgagtctatttaaatattta
gaggttcattattcaagaggtgtacttaaaggagtagaggtttaa

DBGET integrated database retrieval system