KEGG   Taylorella equigenitalis 14/56: KUK_1431Help
Entry
KUK_1431          CDS       T02604                                 

Definition
(GenBank) succinate coa transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
teg  Taylorella equigenitalis 14/56
Pathway
teg00020  Citrate cycle (TCA cycle)
teg00620  Pyruvate metabolism
teg00650  Butanoate metabolism
teg01100  Metabolic pathways
teg01110  Biosynthesis of secondary metabolites
teg01120  Microbial metabolism in diverse environments
teg01130  Biosynthesis of antibiotics
teg01200  Carbon metabolism
Module
teg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
teg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:teg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KUK_1431
   00620 Pyruvate metabolism
    KUK_1431
   00650 Butanoate metabolism
    KUK_1431
Enzymes [BR:teg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     KUK_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: CCG18721
UniProt: I7IJY3
Position
complement(1539129..1540667)
Genome map
AA seq 512 aa AA seqDB search
MTSSNEPFESLSRIRNKSLQSKVMSAEEAAELIPAGSTVGMSGFTGSGYPKRIPAALAKR
IRALNDSGTKFKINVWTGASTAPELDGVLAEVDGINMRLPYQSDPICRKKINSGEMSYMD
IHLSHVAQQAWFGFLGKLNIAVIEVTAINEDGTLVPAGSVGNNKTWIDQADHVILEVNYA
LNEKLDGMHDIYYGTAISPNRKPIMLTKPDQRIGVPHYICPPEKIIGIVETNDFDRVNNF
SEPNDVAKAIAGHILKFFDEEVAKGRFPKNLLPLQSGVGDVSNAVIAGLQHGHFENLTSY
TEVIQDGMLELIKSGKMTSVSATALSLSPSGLKEFNDNIDFYRERIILRTQEISNHPELI
RRLGVIAINGMIEADIYGNVNSTHIMGSGMMNGIGGSGDFTRNSFVSIFVRPSIAKDGAI
SAIVPMVSHHDHTEHDTQIIVTEQGLADLRGLNPSQRAALIIEKCAHPDYKEQLWDYFNR
AKAQDRPRHTPHILSEALSWHDNYEKKGTMKK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaagtaatgaaccatttgaatcactttcacgtattcgtaataagtcgcttcaa
tcaaaagtaatgtctgcagaagaagcggctgagctcataccagcaggctcgacagtcggt
atgagtggatttacaggctctggttatccaaaaagaatacctgcagcattggcaaaaaga
attcgtgctctaaacgattcaggcacaaaattcaaaatcaatgtttggactggtgcttct
acagctcccgaattagatggagtattggctgaagttgatggcattaatatgcgcctgcca
tatcaatccgacccaatttgtagaaagaaaattaattcgggtgagatgtcttatatggat
attcacctttctcatgtggcacagcaagcatggtttgggttcttaggcaaacttaatatc
gcagtaattgaagttactgcaattaatgaagatggtactttagttccagctggttcagta
ggtaataacaaaacatggattgaccaagctgaccatgtgattttggaagtgaattacgct
ttgaatgaaaagcttgatggtatgcacgatatctactatggtactgcaatttctccaaat
cgtaagccgattatgcttacaaaaccagatcaacgtatcggtgtgccacactatatctgt
cctccagaaaaaatcataggtatagtagaaaccaacgattttgatagggtgaataatttc
agtgagcctaacgacgttgcgaaagctattgctggccatatcctgaaattcttcgatgaa
gaagtagctaaaggtagatttcctaaaaatttattgccacttcaatcaggagtaggtgat
gtatcgaacgcagtaattgcgggtttgcaacatgggcatttcgaaaatctgacttcatat
actgaagtaattcaagatggtatgttggagttgattaagtctggaaaaatgacatcagtt
tctgctactgctttatccttaagcccttctggtttaaaagaattcaatgacaatatcgac
ttttatcgtgaacgtattattttacgtactcaagagattagtaatcaccctgaattgatt
agacgtctcggagttattgccataaacggtatgattgaagcggatatctacggaaatgtg
aactccactcatattatgggtagcggtatgatgaacggtatcggaggatcaggcgacttt
actcgtaatagctttgtatcaatctttgttcgcccttcaatcgccaaagacggtgcgatt
tcggccatcgtacctatggtctcacaccacgatcacaccgagcacgatacgcagattata
gttacggagcagggacttgcagatcttagaggattaaacccgtcgcaaagggctgcacta
attatcgaaaaatgtgcacaccctgactataaagagcaactttgggactactttaatcgt
gcgaaggcacaggatagaccacgtcacacacctcatatcttgtccgaagcattgagctgg
cacgataactacgagaaaaaaggtacgatgaagaagtag

DBGET integrated database retrieval system