KEGG   Thermosynechococcus elongatus: tll0078Help
Entry
tll0078           CDS       T00090                                 

Definition
(RefSeq) hypothetical protein
Organism
tel  Thermosynechococcus elongatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BLUF Vps8
Motif
Other DBs
NCBI-GeneID: 1010444
NCBI-ProteinID: NP_680869
CYORF: tll0078
UniProt: Q8DMN3
Structure
PDB: 

Position
complement(70904..71335)
Genome map
AA seq 143 aa AA seqDB search
MGLHRLIYLSCATDGLSYPDLRDIMAKSEVNNLRDGITGMLCYGNGMFLQTLEGDRQKVS
ETYARILKDPRHHSAEIVEFKAIEERTFINWSMRLVQLGEMDSDTIRRLRLKYSPAATFQ
PRSMTAEQCFRFLKELYDMSQGS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgggactacatcgcctgatttatctcagttgcgctacggatgggttatcgtacccagac
ctgcgggatattatggccaagtcagaggtcaacaatttgcgcgatggcattacgggaatg
ctgtgctatggcaatggcatgtttctgcaaacccttgagggcgatcgccaaaaagtcagt
gaaacctacgcccgtattcttaaggatccccgccaccacagcgctgaaattgttgagttt
aaggcaatcgaagagcgaacctttatcaattggtccatgcgtctggtgcagttgggtgag
atggatagcgacaccattcggcgcctgcggttaaaatactctccagcagcaacgtttcag
ccaagatcaatgacggctgagcaatgcttccgtttcttaaaagaactctatgacatgagt
caaggatcctag

DBGET integrated database retrieval system