KEGG   Thermosynechococcus elongatus: tll0422Help
Entry
tll0422           CDS       T00090                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00860  Porphyrin and chlorophyll metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
Module
tel_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    tll0422 (hemB)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     tll0422 (hemB)
Exosome [BR:tel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   tll0422 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-GeneID: 1012667
NCBI-ProteinID: NP_681212
CYORF: tll0422
UniProt: Q8DLQ6
Position
complement(421068..422054)
Genome map
AA seq 328 aa AA seqDB search
MELTHRPRRLRRTAQIRRLVREHTLTTADLIYPVFVMEGEDQAQEVPSMPDCYRYTLDRL
ILELKEVDALGIGAIALFPLVPEHLKDNAGTESYNPEGLVQRSVRAIKEVLPDLLIFTDV
ALDPYSSEGHDGIVKDGEILNDETVEVLVKQAVSQAAAGADFVAPSDMMDGRVGAIRAGL
DAAGYTHVGILAYSAKYASAYYGPFRDALDSAPKFGDKKTYQMDPANVREAVREVSFDIE
EGADMVMVKPALAYMDVIAQLKQVSNVPVAAYNVSGEYAMVKAAARNGWIDEKKVVLETL
LGFKRAGADVILTYHAKQVAQWLQEGLN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagctaacccatcggcctcgccgtttacgccgcacggctcaaattcgtcgcctggtg
cgcgagcataccctaaccacggcggatttgatctatccggtctttgttatggagggggaa
gatcaggcgcaggaagtcccctcgatgcccgactgctatcgctataccctggatcgcctc
attttagagctgaaggaggtcgatgccttgggaattggggcgatcgccctatttcccctt
gtgcctgagcatctcaaggacaatgctggcaccgaaagctacaatcccgaggggctggtc
cagcgatcggtacgagcaattaaggaagtcttgcctgatttgctcatctttacggatgtg
gcccttgatccctacagcagcgaaggccacgatggcattgtcaaagatggcgaaattctc
aatgacgaaactgtggaggtgctggtcaaacaggcagtgagtcaagcggcggcgggggct
gattttgttgccccgtcggatatgatggatggccgtgtcggtgccattcgggcaggtctc
gatgccgcaggctatacccatgtggggattcttgcctactctgcaaaatacgcttccgcc
tactatggtcctttccgtgatgccttagattcagcccccaagtttggcgataaaaagacc
taccaaatggatccggccaatgtccgcgaagcagtgcgggaagtgagcttcgacattgag
gagggggcagatatggttatggtgaaacctgcccttgcctacatggatgtcattgcgcag
ctaaagcaggtgagcaatgttcccgtggccgcctacaatgtttctggcgaatacgcaatg
gtgaaagccgccgcccgcaatggctggatcgatgagaaaaaagtggtgctagaaacccta
ctgggctttaagcgcgcaggtgctgatgtcattctcacctaccatgccaagcaggtggcg
cagtggctgcaagagggattgaactag

DBGET integrated database retrieval system