KEGG   Thermosynechococcus elongatus: tll0574
Entry
tll0574           CDS       T00090                                 

Definition
(RefSeq) lipoyl synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00785  Lipoic acid metabolism
tel01100  Metabolic pathways
tel01240  Biosynthesis of cofactors
Module
tel_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    tll0574
Enzymes [BR:tel01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     tll0574
SSDB
Motif
Pfam: Radical_SAM LIAS_N Ivy
Other DBs
NCBI-GeneID: 1012525
NCBI-ProteinID: NP_681364
CYORF: tll0574
UniProt: Q8DLC2
Structure
PDB: 
4U0O 4U0P

Position
complement(575809..576681)
AA seq 290 aa
MALSRPLPSWLRKPLGKASEISTVQRLVRQYGIHTICEEGRCPNRGECYGQKTATFLLLG
PTCTRACAFCQVEKGHAPAAVDPEEPTKIAAAVATLGLRYVVLTSVARDDLPDQGAGQFV
ATMAAIRQRCPGTEIEVLSPDFRMDRGRLSQRDCIAQIVAAQPACYNHNLETVRRLQGPV
RRGATYESSLRVLATVKELNPDIPTKSGLMLGLGETEAEIIETLKDLRRVGCDRLTLGQY
LPPSLSHLPVVKYWTPEEFNTLGNIARELGFSHVRSGPLVRSSYHAAEGG
NT seq 873 nt   +upstreamnt  +downstreamnt
atggccctctcccgacccctgccgtcgtggctgcgcaaaccccttggtaaagccagtgag
atctctaccgttcagcgcttagtgcgccagtatggaattcacaccatctgcgaggagggg
cggtgtcccaatcgcggggaatgctatggccaaaaaaccgccacctttttacttttgggg
cccacctgtacccgtgcctgtgccttttgccaagtggagaagggtcacgctcccgccgcc
gtggatccagaggagcccactaaaattgccgccgctgtggcgacgttaggcttgcgctat
gtggttttaacctctgtggctcgcgatgacttgccggatcaaggggcgggtcaatttgta
gccaccatggcggcgattcgccaacgctgccccggcaccgaaattgaagtcctcagcccc
gactttcgcatggatcggggtcggctctcccaacgggactgcattgcccaaattgtggcg
gcacagcccgcctgctacaaccacaacctggaaacagtacggcgcttacagggccctgtg
cgacggggtgccacctatgagagctcactgcgcgtcttagccactgttaaagaactcaat
cctgacatacccacaaagtcgggactcatgttgggcctaggggaaacggaagcagagatc
attgagaccttgaaggatctacgcagggtggggtgcgatcgcctgaccttgggacaatat
ctgcccccttccttgagtcatttaccagtggtcaagtattggacccctgaagaatttaac
accttgggcaatattgcacgggaattgggcttttcccatgtgcgatcgggcccccttgta
cgcagctcctaccatgcggctgagggcggctaa

DBGET integrated database retrieval system