KEGG   Thermosynechococcus elongatus: tll0657
Entry
tll0657           CDS       T00090                                 

Definition
(RefSeq) cation-transporting ATPase
Organism
tel  Thermosynechococcus elongatus
Motif
Pfam: E1-E2_ATPase Hydrolase HMA_2 HAD Hydrolase_3
Other DBs
NCBI-GeneID: 1011150
NCBI-ProteinID: NP_681446
CYORF: tll0657
UniProt: Q8DL41
Position
complement(671310..673619)
AA seq 769 aa
MTTIARSRSPQPEIAERPITTETVHYQVVHWIRGRFRIRIPRLGFDAEYGARLLYAVGSL
PAVTAARINPPACSLVVEYNPKLFGEALAMIQGQIFESIQVAANPDLPALSAEKATPAVE
AHPINYWERLGLPALGLGLSVASLMGVPIPGYVIAAVVIAGAMPVFQRAWEAIQEEKQLT
IDFLDGLAIFLHTTQGHYFAPSFMLGLIEGGEVIRDLTARRSERANLDLLDCLGKTAFVE
RDGVEVEVEVKDLVEGDRVVVYPGDQIPVDGLILRGTGLIDQCKLTGESVPVTRTEGMEV
FASTLLVDGQLVILAERVGNNTRAGVIVGLMQSAPVHDTRIENYAAAVANQMVVPTLAIG
TGVGLLSGDLNRAIALLTLDLGTGIRVSVPTTILSALTYAAQHGVLIRSGRAIEKLAQID
TIVFDKTGTLTQGHAGVTAIKAIDPRFSADDILSMAASAEQGLTHPVAEAIVRHARETHQ
PLFDCEDWEYRVGLGVATKVRGVDLRVGSRRMMEQENICLIDLNRRFPDLDSGQASIVYV
AGDGHLIGVILYSDPIRNESPEVIRELKGAGITPHMLTGDIGRVARAVAKDLGIAPNNIY
AEAFPEKKVEVVRALHDSGKVVAFCGDGINDSAALAYADVSISFAGATDIARETADVVLM
EDDLRGLTLAIRIAKQAMEIVWQNTAIVAIPNIGALLSGVFFALDPILAVVINNGTAILA
ELNGLRPLAGPGGPLPLPAVKDTKEFLAEWEATHPDHPVQHRPPKVTGS
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgactactattgcccgcagtcgttccccacagcctgaaatagctgagcggcctatcacc
acagaaactgttcactatcaggttgtgcattggattaggggccgctttcggattcgtatt
ccgcggttgggctttgatgctgagtatggggcacggctgctctacgctgttggcagttta
cccgcagtgacggcggcacgcattaaccccccggcttgctcccttgtggtggaatataac
cccaagctttttggtgaagccctagcaatgattcaggggcaaatttttgagtcaattcaa
gtagccgccaatccagaccttcctgccctgagtgctgaaaaggccacccctgccgttgaa
gctcacccaattaactattgggaacgcctgggcttaccagctctgggtttgggtttgagt
gtggcctccctgatgggggtacccattcccggctatgtgattgctgcggtggtcattgct
ggagccatgccagtgtttcagcgagcctgggaggcgattcaagaggagaaacagttaacg
attgacttcctcgatgggttggccattttcctgcacacgacgcaagggcactattttgcc
ccctcctttatgctgggtctgatcgaggggggggaagtgatccgtgacctcacggcacgg
agatcggaacgggcgaaccttgatttgcttgactgtctcggcaaaaccgcctttgtggag
agggacggcgttgaggtggaggtggaagtcaaggatctcgtggagggcgatcgcgttgtc
gtctatccaggggatcaaattcccgttgatggcctcattttgcggggcacaggcctgatt
gatcagtgcaaactcacgggtgagtcagtccccgtaacccggactgaggggatggaggtt
tttgcttcgacgctcctggtggatggccaattggtgatcttggcggagcgggtgggcaac
aatacgcgggcgggtgtcattgttggcttaatgcagtcggcaccagtgcatgacacacgc
attgaaaactatgctgctgctgtcgccaaccaaatggtggttccgaccttggcgattggc
accggcgtggggttactttcgggggatttgaaccgggcgatcgccctactgacccttgac
ctcggtacggggattcgggtctctgtgccgaccacgattttgtcagccctcacctatgcg
gcccaacatggcgttctcattcgcagtgggcgggcgattgaaaaactggctcaaattgac
acgattgtttttgataaaacaggcacccttacccaaggtcatgctggtgtaacggcgatt
aaagccatcgatcctcgcttcagcgccgatgacatcctcagtatggccgccagtgctgag
cagggactcacccaccccgtagccgaggccattgtccgccatgcccgcgaaacccatcag
cccctctttgactgtgaagactgggaataccgtgttggcctcggggtggccacaaaagtg
cggggtgtagacctgcgggtgggcagccgccgcatgatggagcaggaaaacatttgcctg
attgatctgaatagacgctttcctgaccttgattcagggcaggcttcgattgtctatgtg
gctggggatggccatttgattggcgtgattctctacagcgacccaatccgcaacgaaagc
cccgaagtcatccgtgaactcaagggggcaggcattactccccacatgctgaccggtgac
attggccgcgttgcccgtgcggtggccaaagacttaggaattgctcccaacaatatctat
gccgaagccttcccagaaaagaaagtggaggtggtgcgtgccctccatgacagcggtaaa
gtggtggccttctgtggcgacggtatcaatgactccgcagctcttgcctatgcggatgtc
tctatttcctttgctggggcgaccgatattgcccgtgaaactgcagatgtggtgctcatg
gaggatgatttgcgcgggctgacccttgccattcgcattgccaagcaggcgatggagatc
gtctggcaaaatacggcgatcgttgcgattcccaatattggtgcgctgctgtcgggggtg
ttctttgcccttgacccgattttggcagtggtcattaacaatggcacagccatcttagcg
gagttgaatgggttgcgccccttggcaggtcccggtggtccgttgcccttacctgcggtc
aaagatacgaaggaatttcttgcggaatgggaagcgacccacccagatcacccggtgcag
cataggccaccaaaagtcactggctcttag

DBGET integrated database retrieval system