KEGG   Thermosynechococcus elongatus: tll1506Help
Entry
tll1506           CDS       T00090                                 

Gene name
rbcL
Definition
(RefSeq) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00630  Glyoxylate and dicarboxylate metabolism
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01130  Biosynthesis of antibiotics
tel01200  Carbon metabolism
Module
tel_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tel_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tel_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    tll1506 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll1506 (rbcL)
Enzymes [BR:tel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     tll1506 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 1011208
NCBI-ProteinID: NP_682296
CYORF: tll1506
UniProt: Q8DIS5
Structure
PDB: 

Position
complement(1574633..1576060)
Genome map
AA seq 475 aa AA seqDB search
MAYTQSKSQKVGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAAE
SSTGTWTTVWTDLLTDLDRYKGCCYDIEPLPGEDNQFIAYIAYPLDLFEEGSVTNMLTSI
VGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHYL
NVTAPTCEEMLKRAEFAKELEMPIIMHDFLTAGFTANTTLSKWCRDNGMLLHIHRAMHAV
MDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAVTLGFVDLLRENYIEQDRSR
GIYFTQDWASMPGVMAVASGGIHVWHMPALVDIFGDDAVLQFGGGTLGHPWGNAPGATAN
RVALEACIQARNEGRDLMREGGDIIREAARWSPELAAACELWKEIKFEFEAQDTI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcctatacgcaatccaaatcccagaaagttgggtatcaggcaggggtaaaagactac
cgcctgacctactacaccccggattacacccccaaagataccgatattctagcggccttt
cgtgtgaccccccagccgggcgtcccctttgaagaagcggcggctgccgttgctgcagaa
tcctcaacaggtacatggaccactgtctggactgacctgctgaccgacttggatcgctac
aaaggctgctgctacgacatcgagcccttgccgggtgaagacaatcagttcatcgcctac
attgcctacccgctggatctctttgaagaaggctctgtcaccaacatgctgacctccatt
gtggggaacgtgtttggtttcaaagccctcaaagccctgcgccttgaagacctgcgcatt
cctgtggcttacctgaagactttccaagggccaccccacggtatccaagtggaacgcgac
aaattgaacaaatatggtcgtccgctcttgggctgcaccattaagccgaagctgggtctg
tcggcgaaaaactacggccgtgccgtttatgaatgcttgcgcggtggtttggacttcacc
aaagatgacgaaaacatcaactcccagcctttccaacgctggcgcgatcgcttcctgttt
gttgctgatgccattcacaaagcccaggcggaaaccggtgaaatcaaagggcactatttg
aacgtcaccgctcccacctgtgaagaaatgttgaaacgggcagagttcgctaaagaactg
gaaatgcccatcatcatgcacgactttctcaccgctggcttcacggccaacaccaccctc
tcgaaatggtgccgtgacaacggcatgttgctacacattcaccgtgctatgcacgccgtg
atggaccgtcagaaaaaccacggcatccacttccgtgtcttggccaaatgtttgcggatg
tctggcggtgaccacatccacaccggtaccgttgttggtaagctcgaaggggataaagcc
gttaccctcggctttgtcgatctgctgcgggaaaactacattgagcaggatcgctcccgt
ggtatttacttcacccaagactgggcctcgatgcccggagtgatggccgtggcctccggt
gggattcacgtctggcacatgcctgccctcgtggacatcttcggtgatgatgcagtgctg
caatttggtggtggtaccttggggcacccctgggggaatgcaccgggggcaactgccaac
cgggtcgcccttgaagcctgtatccaagctcgtaatgaaggtcgtgacctcatgcgcgaa
ggcggcgacattatccgcgaagcagctcgctggagtccagaactggctgccgcctgcgaa
ctctggaaagaaatcaagttcgagtttgaagcgcaagacacgatctag

DBGET integrated database retrieval system