KEGG   Thermosynechococcus elongatus: tll1719Help
Entry
tll1719           CDS       T00090                                 

Gene name
desC3
Definition
(RefSeq) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel01040  Biosynthesis of unsaturated fatty acids
tel01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    tll1719 (desC3)
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     tll1719 (desC3)
Lipid biosynthesis proteins [BR:tel01004]
 Desaturase
  First
   tll1719 (desC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 1010561
NCBI-ProteinID: NP_682509
CYORF: tll1719
UniProt: Q8DI71
Position
complement(1800682..1801521)
Genome map
AA seq 279 aa AA seqDB search
MTSSLELQPQTSRLNWGFVLFLGAVHILAAVALFFFSWSALAVTIFLHWLFGSIGICLGY
HRLLSHRSFQVPQWLEYVIAVVGALAMQGGPIFWVAGHRLHHAHTEDEIKDPYSARRGFW
WSHMLWLVYPQSQFFNAEEYARFAPDLTRDPFYRWLDRYFLLLQLPLALLLYGLGGWSWL
LWGMFMRAVFLWHSTWLINSATHKWGYRRFETEDNSRNLWWAALLTYGEGWHNNHHAYPH
VAKAGWYWWEVDPTWWVIRTLQGLGLAAKVQLPPPKALS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatccttagaattgcaaccccagacctcccgcctcaattggggctttgtcctc
tttttaggggcggtgcatattttagccgcggttgcgcttttctttttctcctggtcggca
ttggccgtcaccatctttctgcactggctctttggcagtatcggtatttgcttgggatac
catcgtcttttaagtcaccgcagtttccaagtgccccaatggttggagtacgtcattgct
gttgtgggtgccttggccatgcagggaggcccgattttttgggtggcagggcaccgctta
caccatgcccacaccgaggatgagattaaagatccctactcagcacggcggggcttttgg
tggagtcatatgctgtggctcgtctatccgcagtcccagtttttcaatgccgaggagtat
gcccgctttgcccctgacctcacacgagatcccttttaccgctggctagatcgctacttt
ttactcctgcagcttccccttgcgctgctcctctatggcttagggggttggtcctggttg
ttgtgggggatgtttatgcgagccgtttttctttggcacagcacttggttgattaactct
gccacccacaaatggggctatcgtcgctttgagactgaggataactcacgcaatctctgg
tgggcagccctcctcacctatggtgaaggttggcacaacaaccaccatgcctatccccac
gttgccaaggcgggctggtactggtgggaagtggatcccacctggtgggtgattcgcaca
ctccaaggactcggtcttgccgccaaggtacagttgccaccgcccaaagcgttgtcctaa

DBGET integrated database retrieval system