KEGG   Thermosynechococcus elongatus: tll2115Help
Entry
tll2115           CDS       T00090                                 

Definition
(RefSeq) beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel01130  Biosynthesis of antibiotics
tel01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    tll2115
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    tll2115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:tel01504]
    tll2115
Enzymes [BR:tel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     tll2115
Antimicrobial resistance genes [BR:tel01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    tll2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Beta-lactamase Peptidase_S11 Transpeptidase
Motif
Other DBs
NCBI-GeneID: 1011463
NCBI-ProteinID: NP_682905
CYORF: tll2115
UniProt: Q8DH45
Position
complement(2199796..2200902)
Genome map
AA seq 368 aa AA seqDB search
MGDSARSHDFFRDLSSKVDGMVAQSRSMVQSSGLSSLPRPATPPPPPRPNLFLITFRCGV
SGVALAAMVGTLLSVVHPQDLSLKNTAVQAIAPAPEAPTSTLPPERPLTNLQQQIQQLVS
RQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMR
PDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGL
ENTVINNPLPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAG
LGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQ
AFEKLSPP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgattcagcacgcagccatgatttcttcagagacctttcctctaaagtagatggc
atggttgctcagtctcgttcaatggttcagtcctccggtctttcctcactccctcgtcca
gcaacacctccgccgccaccccgtcccaatttgttcttaattacttttcgctgtggcgtc
agtggggtggcccttgctgcgatggtgggcacactcctctctgtggtgcaccctcaggat
ttgtccctaaagaacacagcggtgcaggcgatcgctcccgctcctgaggcaccaacgtca
accttaccccccgaacgtcccctaaccaacctgcaacagcaaattcaacaactggttagc
cgccaacccaatctgacggcggggctgtacttttttaatttagattccggtgcttccctc
aatgtcggcggcgatcaggtttttcctgccgcctctacgattaagtttcccattcttgtt
gcctttttcaaggcggtggatgagggacgagtcacgctccaggaacgcctcaccatgcgc
cctgatctcatagcccctgaggctggcacattgcaataccaaaagcccaactcccagtac
gccgcccttgaggtggcagagttaatgattacaattagcgacaacacggcaacgaatatg
atcatcgatcgccttgggggcgccgctgagctgaaccaacagtttcaggaatggggctta
gaaaatacggtgattaacaatccgctgccggatatgaagggcaccaacaccaccagtccc
cgggatttggcaacgctgatgctcaaaattggtcagggagaaattctctcgccccgtagt
cgcgatcgcctgctggacatcatgcggcgcacggttactaataccctcttgcccgccggt
cttggcaaaggggccaccattgcccacaaaacgggagatattggtattgtggtcggtgat
gctggcatggtagatatgcccaatggccaacgctatgtagccgccatgatggtgaaacgc
ccctacaatgatccccgagggagtgaactcattcgccaggtctcgcggatggtttaccag
gcctttgagaaactttcgccgccttag

DBGET integrated database retrieval system