KEGG   Thermosynechococcus elongatus: tll2268Help
Entry
tll2268           CDS       T00090                                 

Gene name
pgk
Definition
(RefSeq) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00010  Glycolysis / Gluconeogenesis
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01130  Biosynthesis of antibiotics
tel01200  Carbon metabolism
tel01230  Biosynthesis of amino acids
Module
tel_M00002  Glycolysis, core module involving three-carbon compounds
tel_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tel_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tel_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tll2268 (pgk)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll2268 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tel04147]
    tll2268 (pgk)
Enzymes [BR:tel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     tll2268 (pgk)
Exosome [BR:tel04147]
 Exosomal proteins
  Proteins found in most exosomes
   tll2268 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK rRNA_methylase
Motif
Other DBs
NCBI-GeneID: 1011757
NCBI-ProteinID: NP_683058
CYORF: tll2268
UniProt: Q8DGP7
Position
complement(2357981..2359183)
Genome map
AA seq 400 aa AA seqDB search
MSKKSVAQLSAADLEGKRVLVRVDFNVPVDEKGVITDETRIRAALPTIQDLISKGAKVIL
VSHFGRPKGVDEKLRLTPVAQRLSELLHKPVAKLDDCIGDAVIAHTQAMANGDVCLLENV
RFHPGEEKNDPEFAKQLAACAEVYVNDAFGTAHRAHASTAGVTQYLSPCVAGFLMEKELE
YLQNAIEHPRRPLAAIVGGSKVSSKIGVIEALLEKVDKLLIGGGMIFTFYKARGLNVGKS
LVEEDKLELAKHLETKAQEKGVELLLPTDVVVADNFANDANSQVVSIEAIPDDWMGLDIG
PASVKRFQEALQDCKTVIWNGPMGVFEFDQFAKGTEAIARYLAELTSQGVCTIIGGGDSV
AAVEKVGVADRMSHISTGGGASLELLEGKQLPGIAALDDA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaaaaatccgtagcgcaattatccgctgccgacttagaaggaaagcgtgtcctc
gtgcgggtggattttaatgtccccgtcgatgaaaagggcgtcatcaccgatgagactcgt
atccgtgcggccctgcccaccattcaagacctgatcagcaaaggtgcaaaagtcattctg
gtcagccactttggccgtcccaagggcgtggatgagaagttgcgcctcacccctgtggcc
cagcggctctcagaactgctccacaaacccgtggccaagctcgatgactgcattggcgat
gcggtgatcgcccacacccaagccatggccaacggggatgtctgcctactggagaatgtg
cgcttccatccgggggaagaaaaaaacgatcccgaatttgccaagcaactggccgcctgt
gcagaagtctatgtcaatgatgcctttggcactgcccaccgcgcccatgcctcaaccgct
ggggtgactcagtacctcagtccttgcgtggcgggctttttgatggagaaagaactggaa
tatctgcaaaatgccatcgaacatccccgccgtcccctggcggctattgtcgggggatca
aaagtctcttctaagattggtgtcattgaagcccttttagaaaaagtggataaattgctc
attggcggcggcatgatcttcactttctataaagcgcgggggctcaatgttggcaagtct
ctcgtggaagaagacaaattggaactagccaagcacctggaaaccaaggcccaggagaaa
ggggtggagttgctcttgccaacagatgttgtcgtggcggataactttgccaacgatgcc
aatagccaagtggtcagtatcgaagcgattcctgacgactggatggggctagatattggg
cctgcttctgtcaagcgcttccaagaggcactccaagattgcaaaacggtgatctggaac
ggcccaatgggggtgtttgagtttgatcaatttgccaaggggacagaggcgatcgcccgc
tatttggctgagcttaccagtcagggggtctgcacaattattggcggcggcgattctgtg
gctgctgtggaaaaagttggcgtcgccgatcgcatgagccacatttccaccggtggcggg
gcgagtcttgaactcctcgaaggcaaacaactgccaggtattgctgcccttgatgatgcc
tag

DBGET integrated database retrieval system