KEGG   Thermosynechococcus elongatus: tlr0436Help
Entry
tlr0436           CDS       T00090                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00051  Fructose and mannose metabolism
tel00520  Amino sugar and nucleotide sugar metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    tlr0436
   00520 Amino sugar and nucleotide sugar metabolism
    tlr0436
Enzymes [BR:tel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     tlr0436
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     tlr0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep NTP_transf_3 PGM_PMM_II PGM_PMM_III Hexapep_2
Motif
Other DBs
NCBI-GeneID: 1012678
NCBI-ProteinID: NP_681226
CYORF: tlr0436
UniProt: Q8DLP2
Position
431501..434032
Genome map
AA seq 843 aa AA seqDB search
MRVVVMAGGSGTRLRPLTCDLPKPMVPVVNRPIAEHILNLLRRHNLDDVVMTLHYLPDVV
RDYFGDGNEFGVHLSYVVEEEQPLGTAGSVKNIVNLLTDPFLVVSGDSITDVDLTDALRF
HQQHGAPVTLILARVPQPKEFGIVFTDSDGRVRRFLEKPSAAEVFTDTVNTGIYILNPTV
MDYLNSGIERDFSRDLFPLLLQADVPMYGYITDAYWCDVGSLQTYQQVQQDALYGRVHLE
IQGHEVQPQIWVGHNTPLPPTVQLQAPLVLGNNCRLGAGVTLGPGTVLGDNVMIGNGSRL
RSVVAWNGCFIGDDSELEHCILARHVHVDRHVTLQEGVIIGSRCVVREEASLSQGVRIWP
GKRIEAGAIVNQSLIWGTTGQRYLFGQRGVAGVANVDITPEFAVRLAAAYASILEPGTSV
LVSRDQRNVSRMVSHALMSGLMSVGIHVLNLEAIALPIARFAAQTLSVSGGIHVRAHPDR
ADQLLIEFFDHKGINLSRAKERQIETAYFREEIRRALLTDVGVMTHPNNCVAAYAQGFEK
WLNTQLFYGSPAKIVIDYAYAVSGVVLPQILSKFGCDAVVLNATLHPTPLNILERQRLLR
ELGQVVTALSASLGVQVSANGERLTLVDNAGQVFSDQELTALMTYLTLLTHPGGTVVVPV
TTSSAVEAIARQQGGHIIRSRTNPTDLMEACQHQSGVVLGGSAETGFIFPQLHPGFDAMF
TIATLIELLALIGKPLTVIRQELPRVHYYHRPIRCPWLAKGSLMRHLVETHPRNHLSLID
GVKIGEPNTDHWVLILPDASEPLVHLYVNSPDALWSQQMLQRYSRRIEAFARLEPLSDAT
IKM
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgtcgttgtcatggccggtgggagtggcactcgcttacgccccctaacctgcgat
ctacccaaacccatggtgccggtggtcaatcgtcccattgccgagcatattctcaatctc
ctgcgccgccataaccttgatgatgtggtcatgacattgcattatctccccgatgtggtg
cgggactattttggggatgggaatgaatttggggtgcacctgagctatgtcgttgaggaa
gagcagccccttggcacggcaggttcggtaaaaaacattgtcaatctgctaacggatccg
tttttggtggtcagtggcgatagcattaccgatgtcgatttaaccgatgccctgcgtttt
caccaacagcacggtgctcccgtaaccctgatccttgcccgtgtgccccaaccgaaggag
tttggcattgtctttaccgatagcgatggccgcgtgcggcggtttctcgagaagccttca
gcagcggaagtctttacggacacagtcaatacgggcatctacatcctcaaccccacggtt
atggattacctgaatagcggcattgagcgggatttttcgcgggatctgttcccattgctg
ttgcaggcggatgtgccgatgtatggctatatcaccgatgcttactggtgcgatgtcggc
agtctccaaacctatcaacaggtgcaacaggatgccctctatggtcgggttcacttggaa
attcaggggcacgaagttcagccgcaaatttgggtagggcacaacaccccattgccgcca
acggttcagctacaggcaccgctcgtcttgggcaataactgccgcttgggtgcgggggtc
acccttgggccggggacagtcttgggggataacgtgatgattggcaatggcagtcggttg
cgttcagtggtggcttggaatggctgctttattggggatgacagtgaattggagcattgc
atcttagctcgccatgtccatgtcgatcgccatgtgacactacaggaaggggtgattatt
ggcagtcgctgtgtggtgagggaggaagccagcctgagtcagggagtgcgcatctggcca
ggaaaacgcattgaagccggtgcaattgtcaatcaaagcctgatctggggcacaacaggg
cagcgctatctctttgggcagcggggagtggccggtgtggccaatgtggacattacaccg
gagtttgctgtgcggctggcggcagcctatgcctcaattcttgagcccggaaccagtgtg
cttgtgtcgcgagatcagcgaaatgtatcgcggatggtgtcccatgccctgatgtcgggt
ttgatgtcggtggggattcatgtcctcaatttggaggcgatcgccctgcccattgcccgc
tttgccgcccaaaccctttcagtcagtggggggattcatgtgcgtgcccatcccgatcgc
gccgatcagcttttgattgagttttttgaccacaaaggcatcaacctcagtagagccaaa
gagcggcaaattgaaactgcctacttccgtgaagagattcgccgtgccctactgacggat
gtcggtgtcatgacccatcccaacaactgcgtggccgcctatgcccaaggctttgaaaag
tggctgaatacgcaactgttttatggtagccccgccaaaattgttattgactatgcctat
gccgtttctggggtcgtcttgccccagatcctcagtaagtttggctgcgatgccgttgtt
ctcaatgccaccctccacccaacgcctctaaatattctcgagcgacagcgactcctgcgg
gaactgggacaggtggtgaccgcactttctgcgagtttgggggtgcaagtctccgccaat
ggcgaacggttgaccttggtggacaatgccggtcaggttttcagtgatcaagaactcacg
gccttaatgacctacttaaccctcttgactcatccggggggcaccgtcgtggtgccggtc
acaacctctagtgctgtggaggcgatcgcccgccagcagggaggacacattatccgcagt
cgtaccaacccgactgatctcatggaagcctgccaacaccagagcggcgttgtcctaggg
gggtccgcagaaaccggtttcatcttcccgcaactgcatcctggatttgatgccatgttt
acgatcgccacactgatcgaactgctggcactgattggcaagcccctcacagtgatccgc
caagaactgccccgcgtccactactatcaccgcccgattcgctgtccttggctggctaaa
gggtcattgatgcgccacttagtggaaacccatccccgcaaccatttaagtctcattgat
ggcgtcaaaattggtgaacccaatactgaccattgggtactgattctgcccgatgccagt
gagccactggtacacctctacgtgaatagccctgatgccctttggagtcagcagatgctg
caacgctatagccgccgcattgaagcgtttgcccgcttggaacccctctcagatgccaca
ataaagatgtaa

DBGET integrated database retrieval system