KEGG   Thermosynechococcus elongatus: tsl1825Help
Entry
tsl1825           CDS       T00090                                 

Gene name
phhB
Definition
(RefSeq) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00790  Folate biosynthesis
tel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    tsl1825 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tel04147]
    tsl1825 (phhB)
Enzymes [BR:tel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     tsl1825 (phhB)
Exosome [BR:tel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   tsl1825 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2 Sun2_CC2
Motif
Other DBs
NCBI-GeneID: 1010364
NCBI-ProteinID: NP_682615
CYORF: tsl1825
UniProt: Q8DHW8
Position
complement(1906507..1906794)
Genome map
AA seq 95 aa AA seqDB search
MAERLSPADIEAQLANLPGWKQVGDRLEQTFTFKDFLGSIAFVNRLVDPAEQAGHHPDLS
ISWNRVTVCLTTHDVGGITQKDIDLAKVISNLAVV
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgattatcgccagcggatattgaggcgcagttagctaacctacccggctgg
aaacaggtgggcgatcgccttgagcaaaccttcaccttcaaggacttcctaggttctatt
gcctttgtcaatcgcctggtggatcccgctgagcaggctgggcatcaccctgatttatcc
atctcctggaatcgggtcacagtctgtcttaccacccatgatgtcggcgggattacccag
aaggacattgatctagcgaaggtcatttccaatctggcagtggtataa

DBGET integrated database retrieval system