KEGG   Thermosynechococcus elongatus: tsl2052Help
Entry
tsl2052           CDS       T00090                                 

Gene name
psbM
Definition
(RefSeq) photosystem II reaction center protein M
  KO
K02714  photosystem II PsbM protein
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00195  Photosynthesis
tel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    tsl2052 (psbM)
Photosynthesis proteins [BR:tel00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    tsl2052 (psbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsbM
Motif
Other DBs
NCBI-GeneID: 1011591
NCBI-ProteinID: NP_682842
CYORF: tsl2052
UniProt: Q8DHA7
Structure
PDB: 

Position
complement(2134310..2134420)
Genome map
AA seq 36 aa AA seqDB search
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS
NT seq 111 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaccaactcggcttgattgcaactgccctgtttgtgctggtgccaagtgtg
tttttgattattctgtacgtgcaaacggaaagtcagcagaaaagtagttaa

DBGET integrated database retrieval system