KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0411Help
Entry
TepRe1_0411       CDS       T01495                                 

Definition
(GenBank) Carbon-monoxide dehydrogenase (acceptor)
  KO
K20445  nicotinate dehydrogenase FAD-subunit [EC:1.17.1.5]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00760  Nicotinate and nicotinamide metabolism
tep01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TepRe1_0411
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.5  nicotinate dehydrogenase
     TepRe1_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_5 CO_deh_flav_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEE90612
Position
448574..449446
Genome map
AA seq 290 aa AA seqDB search
MQEFKYFAPSDINQALKILDSVKGDKRILAGGTDLVIAIRERKINPEVVIDLKNTQNLNY
IKQENGYIKIGSMSTFTDVIESELIKRKARVLHESCYSMGSPQIRNWATIGGNIINASPA
TDSVPALMVLDATVKLESVSGIREFKVQDILKGINKTNLNENEILTEISFKIPSENTVTG
FRKLGRRAALSIARISIACLIEVEENTMRCRDARIALGAVAKNPIRATSAEEVLIGKDIS
QKLIDDCVEVISEIAVKNIGNRPSLPFKRQSIKGISRELLNRLYMELWSN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaattcaaatactttgcgccttcagatataaatcaagccttaaaaattcttgac
agtgtaaaaggtgataaaagaatcttagctggaggaactgatctagtcatagctattaga
gaaaggaaaataaaccctgaagtagtaattgatctaaagaatacccaaaatttgaattat
ataaaacaggaaaacggatacatcaagataggttccatgagcacctttaccgatgttatt
gaatcagaactcatcaaaagaaaggcaagagtacttcatgaatcttgttattcaatgggt
tccccccagattagaaactgggctacaattgggggtaacattatcaatgcttcaccggct
acagattctgtaccagcccttatggttcttgatgctacagttaagcttgagagtgtttcg
gggattagagaattcaaggttcaagatattttaaaaggtataaataagaccaatttaaat
gaaaatgagatactgacagaaatatcatttaagataccgtcagaaaacactgtaacaggt
tttagaaaacttggtcggcgtgccgctttatccattgccagaataagcatagcatgtctt
attgaagttgaagaaaacactatgagatgtcgagacgctagaatagccttgggagcagta
gctaaaaatcctataagggcgacttcagccgaagaagtgctaatcggaaaagatatctca
cagaagcttattgatgattgcgttgaagtaatatcagaaatagcggtgaaaaatatagga
aacaggccatcgttacctttcaagcgacagagcataaagggcatttcaagggaattactg
aatcgactttacatggaattatggtcaaactga

DBGET integrated database retrieval system