KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0464Help
Entry
TepRe1_0464       CDS       T01495                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00860  Porphyrin and chlorophyll metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
Module
tep_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TepRe1_0464
Enzymes [BR:tep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TepRe1_0464
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TepRe1_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEE90662
UniProt: F4LUU4
Position
498473..499453
Genome map
AA seq 326 aa AA seqDB search
MKAELVKRPRRLRLNQNIRDMVRETSLNVKDLIYPYFVVEGENVKEEIEAMPKVFHFSID
KLVKDVKETYELGIPAILLFGIPSSKDEVGSQAYASSGIVQRAVRAIKEAIPSMIVITDV
CLCEYTSHGHCGVVESGYVDNDKTLELIAKTALSHAKAGADMVAPSDMMDGRVGCIRQIL
DSEGYVTVPIMAYSAKYASGFYGPFREAAQSAPQFGDRRSYQMDPANSDEALREIALDIE
EGADIVMVKPALAYLDIIRRAKDSFKVPLATYNVSGEYSMIKAAALKGWLDEKVVVLESL
TSMKRAGADMIITYFAKDAAKWLTTR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagaacttgtgaaaagaccgcggcggttaagacttaatcaaaatatcagagat
atggtaagagaaacttcacttaatgtaaaggatctcatatatccttactttgtcgtggaa
ggcgagaatgtaaaagaggaaatcgaggctatgccgaaggtatttcatttttccatagat
aaactggtcaaggatgtcaaagaaacgtatgagcttggaataccggcaattttacttttt
ggcataccctcttcgaaggatgaggtaggaagccaggcttatgcaagctcaggcattgtg
caaagggctgtaagggccataaaagaggcgataccttccatgattgtcataacagatgta
tgcctttgcgaatataccagtcacgggcactgcggagtggtggaaagcggatatgtggat
aatgataaaaccttagaacttatagcaaaaaccgccttatctcatgcaaaagccggagca
gatatggtagcgccttccgatatgatggacggaagggtaggatgcatacgacagatattg
gacagcgaaggctatgtgacagtgccgattatggcttacagcgcaaaatacgcctccggg
ttctacgggccattcagggaagcggctcagtcggctcctcagtttggagatagaagaagc
taccaaatggaccctgcaaattcagatgaagctttaagggagatagcattggatatagaa
gaaggtgctgatatcgtgatggtaaagccggcgcttgcatatcttgacataataaggcgc
gcaaaagacagctttaaggttcctcttgctacatataatgtaagcggggaatactcaatg
ataaaggctgcggcgctgaaaggatggcttgatgaaaaagttgtggtgctagagtcgctg
acatccatgaagcgagcaggtgccgatatgataataacctatttcgcaaaggatgcggca
aaatggcttactacccggtaa

DBGET integrated database retrieval system