KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1689Help
Entry
TepRe1_1689       CDS       T01495                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TepRe1_1689
Enzymes [BR:tep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TepRe1_1689
DNA repair and recombination proteins [BR:tep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TepRe1_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 HHH_2 T2SSE Helicase_RecD AAA_22 PIF1 HHH DUF2075 HHH_3 SRP54 AAA_16 AAA_28 AAA ArgK UvrD_C PhoH NTPase_1 TrwB_AAD_bind DUF853 MobB DEAD UvrD-helicase AAA_24 cobW AAA_14 AAA_5 AAA_12 DUF815 Thymidylate_kin CbiA RsgA_GTPase ATP_bind_1 AAA_18 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEE91825
UniProt: F4LWV3
Position
complement(1741494..1743695)
Genome map
AA seq 733 aa AA seqDB search
MIELEGVVERITYYNEENGFTVAKITVKDNDDLITAIGYFHCLEVGEVLKLRGNWTIHKD
YGHQFKVEFYETIMPATVRGIENYLASGVIRGIGPTMAKKIVKEFGEKTLEVLSNSPEKL
LSVPGIGEKKLKMITESYSQQQETRDIMLFLQEYGIGPNVAVKIYKNYKEKSIQILKQNP
YRLADEVYGIGFKTADYIAQKMGMERDSMERLCAGLKYAVVKAADEGHVFMPLEELLYKA
SELLSVEKEPLNQAFLALEEKKDIVVERAWGREDVYLAAFYYSEKAVARRLFLLAAMIDE
PLEITDETINEIEKCCNIRLAKRQREAIEKAAQHGVLVITGGPGTGKTTTIQSLLEFFKK
QELKVALAAPTGRAAKRMVETTGVEAKTIHRLLEYNAYEQGGMAFGKNQDDPLDEDVIIV
DEMSMVDIILMHHLLSAVRPGARLILVGDKDQLPSVGPGSVLREIIESDKIPVVVLDEIF
RQAQESMIIVNAHRINKGYFPYINVKDKDFFFEQVLLPEDILETILEMTKNRLPNYGDFD
PLEDIQVITPMKKGLVGVANLNDKLQFLLNPPSRRKKEYHYRACVFREGDKVMQIKNNYD
KEVFNGDLGRIVRIDDEDVVIVSFADAWQEREVAYQGQEIEELSLAYALSVHKSQGSEFP
VVIMPITTSHYVMLQRNLLYTAVTRAKKLIVLVGTKQALTIAIQNNRSLRRYGHLSDRII
DEFSQAIFRDGSI
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctggaaggtgttgtagagagaattacatattataatgaggaaaatggtttt
actgttgcaaaaattacagtaaaagataacgatgatttgattacggctatagggtatttt
cactgtcttgaagtcggggaagtattaaaactcaggggaaattggactatacataaagat
tacgggcatcagttcaaggtcgagttttatgagacgattatgccggcgactgtcaggggc
atagaaaactatttggcatcaggggtaattcgcggcataggtcctacaatggcaaagaaa
atcgtgaaagaatttggagaaaaaactttggaggtcttaagtaactcacctgaaaagctt
ttaagtgttcccggtattggagagaaaaaacttaaaatgataactgaatcctatagccag
caacaggaaactcgcgatatcatgttgtttcttcaagaatatggaattggtcctaatgtg
gcggtaaaaatatataaaaactataaagaaaaatcaattcaaatactgaagcaaaaccct
tatcgcttagcagacgaagtgtatggaatcggatttaaaacggccgactacattgctcaa
aaaatgggtatggaacgcgactctatggaacgcctatgtgccggcttgaaatatgctgta
gtaaaggctgcggatgaaggccatgtttttatgccgcttgaggaattgctgtataaagct
tcggaacttttatccgtagaaaaagagcctttaaatcaagcttttttagcgcttgaggaa
aagaaagatattgttgtagagagggcatggggcagggaagatgtgtatttggccgctttt
tactattcggaaaaggccgttgctcgcaggctttttttattggctgctatgatagatgag
ccgttggaaattaccgatgaaactataaatgagatagaaaagtgctgcaatataaggctg
gctaagcgtcaaagggaagctattgaaaaagcggcacagcatggtgtgttggtaattacg
gggggtccgggcaccggtaaaaccacaacaattcagagcttattggaatttttcaaaaaa
caagaattaaaggtggcacttgcagcgccaacgggtcgagctgcaaaacggatggtagaa
accacaggagttgaagcaaaaacaatacacagattgttagaatataatgcatatgagcaa
ggaggcatggcttttggcaagaatcaggacgatcctttagatgaagatgttattattgtc
gatgaaatgtccatggttgatataattctcatgcatcatctgctgtctgcggtaagaccg
ggtgctcgacttattttagtaggagataaagaccagcttccgtcggtaggaccgggcagt
gtcttgagagaaatcattgaaagcgataaaattccagtagtggttcttgatgagatattt
cggcaagcacaggaaagcatgattattgtcaatgcacataggataaataaaggttatttt
ccatatataaatgtgaaagataaggacttttttttcgagcaggttcttctgcctgaggat
atattggaaactatcttggaaatgactaaaaaccgtttgcctaattatggagattttgat
ccgctagaggatatccaggtaattacaccgatgaaaaaagggttagtaggtgttgctaat
ctaaacgacaaattgcagtttcttttaaatccgccaagcaggcgcaagaaggaatatcat
tatcgtgcatgtgtgtttcgtgaaggtgacaaagtcatgcagattaaaaacaattacgat
aaagaagtatttaatggcgacttaggccgaatcgttagaattgatgatgaagatgtagtc
atcgtgagttttgcagatgcatggcaagaaagggaagtggcttatcaaggtcaagaaata
gaagaattgagtcttgcttatgctctctccgttcataagagccaaggcagcgaatttccg
gtagttattatgcctatcacaacctcgcactacgtgatgctgcagaggaaccttttatat
actgccgttacgagggctaagaaactaatagtgcttgtgggtacaaaacaggcactaaca
atagccatacaaaacaacaggtcattgagacgctatggccatctaagtgacaggataatc
gacgaattttcccaagcaatttttagggacggttccatttaa

DBGET integrated database retrieval system