KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2059Help
Entry
TepRe1_2059       CDS       T01495                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Brite
KEGG Orthology (KO) [BR:tep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TepRe1_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 7tm_1 Phtf-FEM1B_bdg
Motif
Other DBs
NCBI-ProteinID: AEE92185
UniProt: F4LR32
Position
complement(2152011..2153063)
Genome map
AA seq 350 aa AA seqDB search
MTVTLEDFLVQLFSNPALIITVLLTLGTVMVNGWTDAPNAIATCISTRSMEPQPAIIMAA
IFNFLGVFVMTIVNSRVAETIYNMVDFGGDAHKALIALCAALFAIVVWATAAWWLGIPTS
ESHALIAGISGAAIALQKGIGGINFDEWIKVLYGLALSMFLGFFSGWLVVKVIEKVFSGF
DRRKTYGLFKYAQIVSAAGMAFMHGAQDGQKFMGVFMLGIFLAQGQASVTEFVIPLWLII
LCSIVMSLGTSIGGMRIIKSVGMEMVKLETYQGFSADLAGVICLFLASVLGLPVSTTHTK
TTAIMGVGAAKRISSVNWGIVREMVIAWLMTFPGCGLISFLLALLFMRLF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacggttactcttgaagattttttagtacaattattttcaaacccagctttgattatt
actgtattgttgacactaggaactgttatggtcaacgggtggaccgatgctccaaatgct
attgcgacatgtatttctacacgttccatggaaccacaacctgcaattattatggctgct
atttttaatttcttaggtgtatttgttatgacaatagttaattcgagggtagcagaaacc
atatataatatggtggactttggaggagatgctcataaagctcttattgcattgtgtgcg
gctttatttgcaattgtggtatgggctaccgctgcatggtggttgggcataccgactagc
gaaagtcatgcattgatagcaggtataagcggcgctgcaatagcactgcaaaagggcatt
ggcggtatcaatttcgatgaatggataaaagttttatatggattggcattatccatgttc
ttaggttttttttccggatggttagtagttaaagtaatcgaaaaggtttttagcggcttt
gaccgtagaaaaacatatggtttgtttaaatatgctcaaatagtcagtgccgccggtatg
gcctttatgcatggtgctcaggacggtcaaaagttcatgggtgtgtttatgctcggcata
tttcttgcacaagggcaagcttcggttactgaatttgttattccgttatggttgattata
ttatgctccatagtgatgtcactggggacatccataggcggtatgcgaattatcaaatcc
gtaggaatggaaatggtgaaacttgaaacctatcaaggattttctgcagatcttgcaggt
gttatatgcttatttctagcttctgtgctgggactacccgtcagcactacgcataccaag
acaacggctataatgggagtaggtgcagcaaagagaatctcatccgtaaattggggaatt
gtaagagaaatggtaattgcctggttgatgacttttccgggctgcggattaattagtttt
ttattggcattactatttatgagattattttaa

DBGET integrated database retrieval system