KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2200Help
Entry
TepRe1_2200       CDS       T01495                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00010  Glycolysis / Gluconeogenesis
tep00020  Citrate cycle (TCA cycle)
tep00620  Pyruvate metabolism
tep00633  Nitrotoluene degradation
tep00640  Propanoate metabolism
tep00650  Butanoate metabolism
tep00680  Methane metabolism
tep01100  Metabolic pathways
tep01120  Microbial metabolism in diverse environments
tep01130  Biosynthesis of antibiotics
tep01200  Carbon metabolism
Module
tep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_2200
   00020 Citrate cycle (TCA cycle)
    TepRe1_2200
   00620 Pyruvate metabolism
    TepRe1_2200
   00640 Propanoate metabolism
    TepRe1_2200
   00650 Butanoate metabolism
    TepRe1_2200
  Energy metabolism
   00680 Methane metabolism
    TepRe1_2200
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TepRe1_2200
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TepRe1_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEE92322
Position
complement(2301988..2302935)
Genome map
AA seq 315 aa AA seqDB search
MATLKELAQVEERFVGGHRLCAGCGHGISVRMVLNALENDENVVVGCATGCLEVASTIYP
YTAWNCSFIHNAFENAAATISGVEAAYRSLKKQGKLKDDFKFVAFGGDGGTYDIGLQSLS
GAMERGHKMVYVCLDNGAYMNTGIQRSSATPIGADTTTSPAGKVIPGKQQPRKDLAALIA
AHNIPYVAQTAISNWQDVHKKAKKAFEVDGPAFINILSPCPRGWRYNTPDIVDLVKKAVE
TRFWPLYEVEDGKWKLNSKPKKYVSVEEFLKPQGRFKHVFAPGNEDLLKRIQEEVDKQWL
ALLERCGEEPELPPR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctacattaaaagaacttgctcaagttgaagaaagatttgtcggaggtcataggctt
tgtgccggatgcgggcatggtatttcagtgcgcatggttttaaatgccctggaaaacgat
gaaaatgtagtagtaggttgtgctacaggctgccttgaagttgcctccacaatatatcca
tatacggcgtggaattgttcctttatacacaacgcatttgaaaatgctgctgctaccatc
agcggtgtagaagctgcatatagatcattaaagaaacagggtaaattgaaggatgacttt
aaatttgtggccttcggtggtgacggagggacttatgatataggcttgcaatcactttcc
ggtgctatggagcgaggccataagatggtatatgtctgtcttgataatggtgcttatatg
aataccggtattcagcgttcaagtgcgacacctataggtgccgatactactacgagccca
gctggaaaggttattcccggaaaacagcagcctcgtaaggacttggcagccttaatagca
gcacataatataccctatgtagctcagacggcaataagcaattggcaggatgtccataaa
aaggcaaagaaggcctttgaagttgacggcccagcttttatcaatattttatcaccttgc
ccgcgaggatggaggtacaacactccggatattgtggacttggttaaaaaggctgtcgaa
acacgtttttggcccctttatgaggtggaagacggtaaatggaaacttaatagtaaacct
aagaaatatgtatctgttgaagaatttttaaaacctcaaggaaggtttaaacatgtattt
gcaccgggtaatgaagatttactgaagcgcattcaagaagaagtggacaaacagtggctt
gctcttcttgaacgttgtggcgaagaacctgaattacccccacgttaa

DBGET integrated database retrieval system