KEGG   Taylorella equigenitalis MCE9: TEQUI_0018Help
Entry
TEQUI_0018        CDS       T01390                                 

Definition
(GenBank) Aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00010  Glycolysis / Gluconeogenesis
teq00053  Ascorbate and aldarate metabolism
teq00071  Fatty acid degradation
teq00280  Valine, leucine and isoleucine degradation
teq00310  Lysine degradation
teq00330  Arginine and proline metabolism
teq00340  Histidine metabolism
teq00380  Tryptophan metabolism
teq00410  beta-Alanine metabolism
teq00561  Glycerolipid metabolism
teq00620  Pyruvate metabolism
teq00625  Chloroalkane and chloroalkene degradation
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01120  Microbial metabolism in diverse environments
teq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:teq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_0018
   00053 Ascorbate and aldarate metabolism
    TEQUI_0018
   00620 Pyruvate metabolism
    TEQUI_0018
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TEQUI_0018
   00561 Glycerolipid metabolism
    TEQUI_0018
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TEQUI_0018
   00310 Lysine degradation
    TEQUI_0018
   00330 Arginine and proline metabolism
    TEQUI_0018
   00340 Histidine metabolism
    TEQUI_0018
   00380 Tryptophan metabolism
    TEQUI_0018
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TEQUI_0018
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TEQUI_0018
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TEQUI_0018
Enzymes [BR:teq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TEQUI_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ADU90977
UniProt: E8UCZ3
Position
complement(24534..26027)
Genome map
AA seq 497 aa AA seqDB search
MIQELMKKFGVSESKFQGGGLAVRSPIDGKNIGNVAVNTPEEVDGIIEKSNQAFKEWRKV
PAPRRGELVRILGNVLREHKEDLGKLVSLEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTISSERNMHHMRETWHPIGIVGIISAFNFPVAVWSWNAALALICGDSIIWKPSEKTPL
TALACQALFEKALREFGDDAPENLSQVVIGDAKVGDMLVTDPRIPVISATGSTRMGQIVG
PKVAERFGRSILELGGNNAMILTPSADLDLAVRAILFSAVGTAGQRCTTLRRLIVHESIR
DEVVEKLKKVYGSVSIGNPLEGNLVGPLIDEHIFNQMQSILKKATEAGGKVFGGKRVLED
KYPDAYYVEPAIVEMDEQNEVVKTETFAPILYVISYSDYEDAIELQNNVPQGLSSCVFSN
DIREAEAFISATGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYMRRQTN
TINYSRELPLAQGINFG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagaacttatgaaaaaatttggtgttagcgagtctaaatttcaaggtggaggc
ttagctgtaagatcgcctattgatggtaaaaatatcggaaatgtagctgttaacacacct
gaagaagtagatggaattattgaaaaatctaatcaagcatttaaagaatggagaaaggtt
ccagcacctcgtcgcggagagttagtacgtattttgggtaatgtacttcgtgaacacaaa
gaagatttaggaaaattggtatcccttgaagctggaaaaatcacccaagaaggattgggc
gaagtgcaagagatgattgatatctgcgattttgcagttggtctatctcgccaactttat
ggcctaactataagctcagaacgtaatatgcatcacatgcgtgaaacatggcatccgatt
ggaattgtaggaattatttctgcgtttaattttcctgtggcagtatggtcttggaatgct
gcacttgctttgatttgcggtgactctattatttggaagccatcagaaaaaacaccttta
actgcattagcatgtcaggctttatttgaaaaagcactaagggaatttggagatgatgct
ccagaaaatttatctcaagttgtgataggagatgcaaaagtaggggatatgttggttaca
gatccacgcattcctgttattagtgctacgggttctacacgaatgggtcagattgttggt
cccaaagtggcagaaagatttggtcgaagcattcttgaattaggggggaataatgcgatg
attctcaccccaagtgcggaccttgatcttgctgttcgtgcgatattattctctgctgtt
ggtactgcaggtcaaaggtgtacaactcttcgtcgtctaattgttcacgagagcattcga
gatgaagttgttgaaaaacttaaaaaggtttatggttctgtttctattggaaatcctcta
gagggcaaccttgtaggtccgcttattgatgagcatatttttaatcaaatgcaaagcatt
cttaaaaaggctacagaggcaggcggtaaagtatttggaggtaagcgagttttagaggat
aagtatcctgatgcttattatgtagaacctgcaattgttgagatggatgagcaaaatgag
gtggttaaaactgaaaccttcgcaccgattttgtatgtaatttcttattcagattatgag
gatgctattgaacttcaaaataacgtacctcagggcttgtcatcttgcgtattctcaaat
gatattcgtgaggcagaagcatttatttctgctacaggaagtgattgcggcatagctaac
gttaatatcggaacaagtggtgctgaaattggcggagctttcggcggagaaaaagaaaca
ggtggaggtcgagagtctggttctgatgcatggaaggcttatatgcgcagacagacaaat
accatcaattattcacgagagcttcctctagcccagggtattaacttcggctag

DBGET integrated database retrieval system