KEGG   Taylorella equigenitalis MCE9: TEQUI_0117Help
Entry
TEQUI_0117        CDS       T01390                                 

Definition
(GenBank) Peptidoglycan hydrolase VirB1
  KO
K03194  type IV secretion system protein VirB1
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:teq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TEQUI_0117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0117
Secretion system [BR:teq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   TEQUI_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT IpaC_SipC Zein-binding
Motif
Other DBs
NCBI-ProteinID: ADU91073
UniProt: E8UDG5
Position
130277..131008
Genome map
AA seq 243 aa AA seqDB search
MKKLIYITLFLMAYSSNANANDYDDVIKSCSPNVAPETMRAIIRVESSFNPYAIGVVGGE
VKQPKTLDEALKTVQKLKKEKLNFSMGLAQINRYNLSKYNLTEVSVFNPCSNLKASEAIL
SECFQRAKSEGSNDQVALQKALSCYFAGNFSTGFKKSKGLSYVDKIKRVALANEGFLVPK
INPKVDYTPTPKGKGEFEKVKESEKVFNPKDSNGNDDSKQKEKKYYEWDLFNDFALEGGM
YMK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatctacataactctttttttgatggcatattctagcaatgctaatgca
aatgactatgatgatgttattaaatcatgttcaccaaatgtagccccagagactatgagg
gcaattataagagttgaaagctcttttaacccttacgcaattggagttgtaggcggtgaa
gtgaaacagccaaaaacattagatgaagccttaaagacagtgcaaaagctaaaaaaggag
aaattaaatttctcaatgggtttagcacaaatcaatagatataacctctctaaatataac
ttaacggaagtatcagtttttaacccatgctcaaatctaaaagctagcgaagcaatttta
agtgagtgttttcaaagggctaaaagcgaaggtagcaacgatcaagtagctttacaaaaa
gctttaagttgttattttgcaggcaatttttctactgggtttaaaaaatctaaaggctta
agttatgtagataagattaaaagagtagcccttgctaatgaaggatttctggttcctaaa
atcaatcctaaagttgattacacacctaccccaaaaggcaaaggtgagtttgagaaagta
aaagagagtgaaaaagtttttaatcctaaagactctaatggtaatgatgatagtaagcaa
aaagagaaaaaatactatgagtgggatttatttaacgattttgcactagaagggggaatg
tatatgaaataa

DBGET integrated database retrieval system