KEGG   Taylorella equigenitalis MCE9: TEQUI_0132
Entry
TEQUI_0132        CDS       T01390                                 
Name
(GenBank) Minor pilin of type IV secretion complex, VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:teq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TEQUI_0132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0132
Secretion system [BR:teq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   TEQUI_0132
SSDB
Motif
Pfam: T4SS COG4_N DUF2452 Het-C BLOC1_2 DUF948 ssDNA_TraI_N SKA1 IFT20 Nuf2_DHR10-like S6OS1 COG3_N
Other DBs
NCBI-ProteinID: ADU91088
UniProt: A0A654KF86
Position
141734..142363
AA seq 209 aa
MKLSKLFLYTVLSVGFANVHAGGIPVIDTAQLTQEAQNFLKSLAEMKNQVENQIKQITEL
KAQVSALTSQRGLGNVLRDELKSNIPDSWKEMYGKVGNLDILKGENFDPEGSAKNLVAML
EGTEKSFDSIKERMKKIDELTNLINTTKDIKETGDLQARIQSEQLAITNEQIKLDQLARA
YEIQKEVNSKQRIRQETCSLAKWAGRTCE
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaaattgtctaaattatttttatatactgtattaagtgtaggatttgccaatgtacac
gctggaggtattcctgtaattgataccgcccagttaacccaagaggcacaaaactttctt
aaatctctagcagagatgaaaaatcaagttgaaaaccaaattaaacaaattaccgaactt
aaagcacaagtcagtgctttaacaagccaaagaggcctaggtaatgtattgcgtgatgag
ttaaagtctaatattcctgattcttggaaagaaatgtatggaaaagtaggcaatttagat
attcttaaaggtgaaaactttgatccagaaggttctgctaaaaacctagtagcaatgctt
gaggggactgaaaaatcattcgattcaatcaaagaaagaatgaagaaaattgatgaactt
accaatttaattaatacaactaaagatattaaggaaactggtgacttacaagcacgtatt
caatccgaacaattagctataactaatgaacaaattaaattggaccaattagcaagagct
tatgaaattcaaaaagaagttaattcaaaacaaagaattcgtcaagaaacttgtagctta
gctaaatgggcagggcgaacttgcgaatag

DBGET integrated database retrieval system