KEGG   Taylorella equigenitalis MCE9: TEQUI_0132Help
Entry
TEQUI_0132        CDS       T01390                                 

Definition
(GenBank) Minor pilin of type IV secretion complex, VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq03070  Bacterial secretion system
Module
teq_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:teq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TEQUI_0132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0132
Secretion system [BR:teq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   TEQUI_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS DUF2452 BLOC1_2 Het-C DUF948 DUF885 WHEP-TRS ssDNA_TraI_N EcoEI_R_C PIN_12 DHR10 Mod_r
Motif
Other DBs
NCBI-ProteinID: ADU91088
UniProt: E8UDI0
Position
141734..142363
Genome map
AA seq 209 aa AA seqDB search
MKLSKLFLYTVLSVGFANVHAGGIPVIDTAQLTQEAQNFLKSLAEMKNQVENQIKQITEL
KAQVSALTSQRGLGNVLRDELKSNIPDSWKEMYGKVGNLDILKGENFDPEGSAKNLVAML
EGTEKSFDSIKERMKKIDELTNLINTTKDIKETGDLQARIQSEQLAITNEQIKLDQLARA
YEIQKEVNSKQRIRQETCSLAKWAGRTCE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtctaaattatttttatatactgtattaagtgtaggatttgccaatgtacac
gctggaggtattcctgtaattgataccgcccagttaacccaagaggcacaaaactttctt
aaatctctagcagagatgaaaaatcaagttgaaaaccaaattaaacaaattaccgaactt
aaagcacaagtcagtgctttaacaagccaaagaggcctaggtaatgtattgcgtgatgag
ttaaagtctaatattcctgattcttggaaagaaatgtatggaaaagtaggcaatttagat
attcttaaaggtgaaaactttgatccagaaggttctgctaaaaacctagtagcaatgctt
gaggggactgaaaaatcattcgattcaatcaaagaaagaatgaagaaaattgatgaactt
accaatttaattaatacaactaaagatattaaggaaactggtgacttacaagcacgtatt
caatccgaacaattagctataactaatgaacaaattaaattggaccaattagcaagagct
tatgaaattcaaaaagaagttaattcaaaacaaagaattcgtcaagaaacttgtagctta
gctaaatgggcagggcgaacttgcgaatag

DBGET integrated database retrieval system