KEGG   Taylorella equigenitalis MCE9: TEQUI_0719Help
Entry
TEQUI_0719        CDS       T01390                                 

Definition
(GenBank) Uncharacterized protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
teq  Taylorella equigenitalis MCE9
Brite
KEGG Orthology (KO) [BR:teq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0719
Secretion system [BR:teq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TEQUI_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ADU91657
Position
749250..750743
Genome map
AA seq 497 aa AA seqDB search
MATEALKQSQEKGTIEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSD
SYITIQNIIAEIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVNNTETDEMLKIRFMPIS
KKELGRTLKRHKGTAWDQSPIFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEM
AKISAAAHCPFISGADPSLMQMDSWQELSNPRDLSKIFTNTEYAAWRSLRETDDSRYLGL
TLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANSAYAMAANINRSFKEYGWCTS
IRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDFA
AFIGAQSLQKPAEYDDPDATANARLSARLPYLFACCRFAHYLKCIVRDKVGSFTSRIEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGL
TVSLRLVSKLPSLKKAG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaagctttaaaacaaagtcaagaaaaaggcacgattgaagttgagggctta
tcttcacttcttaaaaaagaatttaaacctaaaacagaagaagcacaaagtgctgttgaa
agtgcagttaaaactctagctgaacaagcactttcatctgctgtaactatctcctcagat
tcatacattactattcaaaatattattgctgagattgatcgtaaattatctcaacaaatt
aacgtaattcttcataacgaagagttccaaaaactagaaggtgcttggcgcggtctacat
tacttagttaataacactgaaacagatgagatgttaaaaatccgtttcatgcctatttct
aaaaaagaattaggtcgtacattaaaacgtcacaaaggtacagcatgggaccaaagtcct
atattcaaacgtatatacgaagaagagtatggtcaattcggtggtgaacctatcggatgt
atcgttggagattatcacttcgatcacagtcctccagatgtagagcttttaggtgaaatg
gctaagatatctgctgctgctcactgcccatttatctctggtgctgacccttcacttatg
cagatggattcatggcaggaactttcaaatccacgtgatttaagcaaaatcttcacaaat
actgagtatgcagcatggagaagcctacgtgaaactgatgactcacgttatttaggtttg
acattgcctcgcttcctggctcgtctaccatacggtgctcgtactaatccagttgatgag
tttgatttcgaagaagatacagaaggtgcaaaccacaataactacacttgggctaactct
gcatatgcgatggctgcaaatatcaaccgttcatttaaagagtatggttggtgtacatca
attcgtggtgtagagtcaggtggtgcggttgaaggcttacctactcacacattccctacc
gatgacggtggcgtggatatgaaatgtccaactgaaattgctatttcagaccgtcgcgaa
gctgaactagctaaaaatggtttcatgccactagttcaccgtaaaaattcagactttgct
gcgtttatcggagctcagtcattgcaaaaacctgcagagtatgatgatcctgatgcaaca
gcaaatgctcgtctttctgcacgtttaccttatttgtttgcttgctgccgtttcgcacac
tacttaaaatgcatcgtgcgtgataaagtgggttcatttactagtcgtattgagatggaa
gattggttgaatacttggattatgaactatgttgatggagatccagctaactcttctcaa
gaaactaaagctcgtaaaccacttgctgctgctgaagtacaagttgcggagattgaagat
aatccaggctattatgctgctaaattcttcttgcgtccgcattatcagttagagggttta
accgtttcattaaggttagtctctaaactgccatcccttaaaaaggctggctaa

DBGET integrated database retrieval system