KEGG   Taylorella equigenitalis MCE9: TEQUI_0721
Entry
TEQUI_0721        CDS       T01390                                 

Definition
(GenBank) Protein of avirulence locus ImpE
  KO
K11898  type VI secretion system protein ImpE
Organism
teq  Taylorella equigenitalis MCE9
Brite
KEGG Orthology (KO) [BR:teq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0721
Secretion system [BR:teq02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   TEQUI_0721
SSDB
Motif
Pfam: ImpE TPR_19 TPR_17 P53_C
Other DBs
NCBI-ProteinID: ADU91659
UniProt: A0A654KGY3
Position
751384..752217
AA seq 277 aa
MNTAGIFKTNSIDEVIEQTKDKVRKNPDSADLRANLFQLLALKGDWTRAVDSLKLSAEMN
SQAQPVAMLYVAAVNAEVDRQNVFQGNGRPAIFGDADEWMGYLIASIEEKDPSKSEELLD
KAMELAPEVSGTIKTRNGEEVNFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIESLRIIE
PSGISDLIWSQAELVLTNGRSIVGMVPNRYPGDYASLDDKFNLGHRTEWVPLFESEESEY
YKGVGQKTYISDLGDHPILEIESIKFNPVLTQDDAES
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaacacagctggtatttttaaaacaaattctattgatgaagttattgagcaaaccaag
gataaagttcgtaagaatccagacagtgcggatttgcgtgcaaatttatttcagctttta
gcacttaaaggggattggactagagctgttgattctctgaaactaagtgctgagatgaat
tcgcaagcacaacccgttgccatgctttatgtagccgctgttaatgctgaggttgacagg
caaaacgtcttccagggtaatggcagacctgctatttttggtgatgctgacgagtggatg
gggtatctaattgcctctattgaggaaaaggatccatctaaatctgaagaattgttagat
aaagctatggaacttgctcctgaagtatcaggaactattaagactagaaacggtgaagaa
gttaattttgaatggctagcagacggagatagccgcctaggtcctatgttggaatttcta
aataatggtcaatatggttgggtaccatttaatgaaatcgaatcgcttcgtatcattgaa
ccttcaggtatctctgatttaatatggtctcaggctgaattagttcttactaacggaaga
tctatagtaggcatggtgcctaatcgttatcctggtgattatgcttcactagatgataaa
ttcaatctaggacatcgtacagagtgggtaccactttttgaatcagaagaatcagaatac
tataaaggtgtaggtcaaaagacatacatttctgatttgggcgatcacccaattttagaa
attgaatctattaaatttaatccagttttaactcaggatgatgcggaaagctga

DBGET integrated database retrieval system