KEGG   Taylorella equigenitalis MCE9: TEQUI_0929Help
Entry
TEQUI_0929        CDS       T01390                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00450  Selenocompound metabolism
teq00970  Aminoacyl-tRNA biosynthesis
teq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:teq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TEQUI_0929
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TEQUI_0929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:teq01007]
    TEQUI_0929
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:teq03016]
    TEQUI_0929
Enzymes [BR:teq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TEQUI_0929
Amino acid related enzymes [BR:teq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TEQUI_0929
Transfer RNA biogenesis [BR:teq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TEQUI_0929
 Prokaryotic type
   Other AARSs
    TEQUI_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f GrpE
Motif
Other DBs
NCBI-ProteinID: ADU91860
UniProt: E8UG96
Position
complement(947886..949967)
Genome map
AA seq 693 aa AA seqDB search
MARTIFATTALPYANGSFHIGHIMEFIQADIWVRAMRMFGHKVYFMGADDAHGAPIMLKA
QAEGITPEELVSRIASERPQYLNGFQIKHDFWHSTHSTENIEVSQNIYKALKKNGFISTK
TIEQFFDPIKGMFLPDRYIKGECPKCHAKDQYGDSCEVCGAVYAPTDLIEPYSTLTKASP
ELRTSEHFFFNLSDPRCIQFLHDWTNNSGNLNKTHLQGEVLAKTKEWLGDSESDSKLGDW
DISRDAPYFGIPIPDEKDKYFYVWLDAPAGYLAALKAYTKKEGLDYDSIVDPKGETSQIH
FIGKDIIYFHALFWPAMLKFSDRKVPDRIQVHGFITVKGEKMSKSRGTGISPLKYLSVGL
NPAYLRYYIAAKLSAKVEDVDFTAEDFMVRVNSDLVGKYVNIASRASTFINRFFDGHLSF
KTEEQFEEIKKLTDEVKADIENFEYSKAVRAIMAFADKVNTAFDQAKPWVLAKGFSEASD
ETKAQLQDICSQAIAGFKAICTLLYPITPELSTSIYEDLFDIKKDLVWDDAYEKPLLIKP
FKHLLQRVEEKQLDELFEPTTDQKVTESEEKLIPGGQAIADTITIDDFSKVDMRVAKIVD
CKKVEGSTKLLQLTLDVGEGRNRNVFSGIQSAYEPEDLIGKLTVVVANLAPRKMKFGVSE
GMVLSAAHADREVVPGLWILEPQSGAQPGMRIG
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcactatattcgccacaactgcccttccatacgcaaatggttcgtttcatatc
ggacatatcatggagtttattcaagctgatatttgggttagagccatgcgtatgtttggg
cataaggtttatttcatgggggcggacgatgctcatggagcacccatcatgcttaaggct
caagctgagggcatcactcctgaagaattagtatcacgtatagcaagcgagagaccacaa
tatttaaacgggtttcaaattaagcatgacttctggcatagtactcatagcacagaaaat
atcgaagtttcacaaaacatatacaaagctctaaagaaaaatggatttatttctactaag
accatagagcaattctttgaccctataaaggggatgtttcttcctgatcgatatatcaaa
ggcgaatgtcctaagtgtcatgcaaaagatcagtatggagattcatgcgaagtttgtggg
gcagtttacgcacctacggatttaattgagccttactctactcttacaaaggctagtcct
gaacttagaacctctgagcatttcttttttaatttatctgacccaagatgtatacaattc
cttcacgattggacaaacaattcaggtaatctaaataaaacacatctccaaggtgaagtc
ctagccaaaacaaaagaatggttaggtgattcggaaagtgatagcaaattaggggattgg
gatatctctagagatgcaccatatttcggcatacctatcccagatgaaaaagataagtat
ttttatgtttggcttgatgctcctgctggctatttagctgcattaaaagcctatactaaa
aaagaaggtttggattacgattctattgtcgatccaaagggagaaacttctcaaatccac
tttatcggaaaagacattatttattttcatgctttgttttggcctgccatgcttaagttc
tccgatagaaaagttccagatcgcatacaggttcacggatttataactgttaaaggcgaa
aagatgtccaaaagccgaggtacaggtatctctccacttaagtacttaagtgtagggtta
aatccagcatatcttagatactatatcgctgctaaattaagtgctaaagttgaagacgtg
gattttacagctgaggattttatggtccgtgtaaattcagatttagtaggcaagtacgta
aacattgccagccgtgctagtacatttataaatcgcttttttgatggtcatttatctttt
aaaactgaagagcaatttgaggaaatcaaaaaacttacagatgaagtcaaagctgacatt
gagaattttgaatattctaaagctgttagagccattatggctttcgcagataaagtaaac
actgcgttcgatcaggctaaaccctgggttcttgctaaaggattctctgaagcttcagat
gaaaccaaggcacaattacaggatatttgctcgcaggcgattgctgggtttaaagctatc
tgtacactgctttaccctattactcccgaattaagcacctctatttacgaggatttattt
gatatcaaaaaagatttggtttgggatgatgcctatgagaaacctctattgatcaaacca
ttcaagcatttacttcaaagagttgaggaaaaacaattggacgaattatttgaacctact
acagatcaaaaagtgactgaaagtgaagagaaacttattcctggaggacaggctattgca
gacacaataactattgatgatttttcaaaagttgatatgcgtgtagcgaaaattgtggac
tgcaaaaaagttgagggttcaactaaattactacaacttacattggacgtgggcgaaggt
agaaatcgtaatgtgttctctggcattcaatcagcttatgaaccagaagatcttatcggc
aaactaactgttgttgtagctaatcttgctcctagaaaaatgaaatttggagtttctgaa
ggtatggtgttgtctgctgctcatgctgacagagaggtggttccaggactatggatttta
gaaccacagtcaggagctcagccaggcatgcgtatcggttga

DBGET integrated database retrieval system