KEGG   Taylorella equigenitalis MCE9: TEQUI_1388Help
Entry
TEQUI_1388        CDS       T01390                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00010  Glycolysis / Gluconeogenesis
teq00020  Citrate cycle (TCA cycle)
teq00620  Pyruvate metabolism
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01120  Microbial metabolism in diverse environments
teq01130  Biosynthesis of antibiotics
teq01200  Carbon metabolism
Module
teq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_1388
   00020 Citrate cycle (TCA cycle)
    TEQUI_1388
   00620 Pyruvate metabolism
    TEQUI_1388
Enzymes [BR:teq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TEQUI_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N CAT
Motif
Other DBs
NCBI-ProteinID: ADU92302
UniProt: E8UDC4
Position
1467922..1469367
Genome map
AA seq 481 aa AA seqDB search
MSQLIEVKVPDIGDFDDVSVIEVLVKEGDKISVDQSIITVESDKASMEIPSSASGIIKKL
SVKLGDKVKEGVVLLTVESTDGDSKGQSSEISQIDDSKAADNSVNEKNVSKEQGAGGDSG
IYDIKASQLTQEKQNTVEDNASSMTFVAQSSDAGDKVGKSKESPTAAYALTANEIRNLPH
ASPSVRQFARSLGVDLNQVKGTGRKNRIVLDDVRSFVKSALSAPGGVTTGSSTLGGSGLS
VLDWPKVDFSKFGEIDSKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLEAFRVQLN
KEHEKAGIKFTMLAFIFKAVVQALKKYPEFNSSIDGENIVYKKYFHLGFAADTPNGLVVP
VIRDADKKSISDIAKETSELAKLARDGKLSPSQMQGGCFTISSLGGIGGTHFTPIINAPE
VAILGVSRSYQKPVWNGKEFQPRLTLPLSLSYDHRIIDGAAAARFNVCLCQILSDFRRAM
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattaattgaagtaaaagttcctgatataggcgattttgatgatgtatctgtt
attgaagtgcttgttaaagagggggataaaatttctgtagaccaaagtattataactgtt
gagtccgataaagcctctatggagattccaagtagtgcttctggaatcattaaaaaacta
tcagttaaattgggagacaaagttaaagaaggagtggtgctgttaactgttgaatcaact
gatggcgactctaagggtcaatcttctgaaatttcacaaattgatgattctaaagcggct
gataattctgttaatgagaaaaatgtttccaaagagcagggagctggaggggattcagga
atttatgatattaaagcatctcaattaacacaagaaaaacaaaatacagttgaagataat
gcgtcttctatgacatttgttgctcaatcttctgatgctggagataaggttggcaaaagt
aaagaatcacctactgctgcttatgctttaactgcaaacgaaatacgtaatcttccacat
gcatctccatctgtaaggcaatttgctcgttccttaggtgtagatttaaatcaagtaaaa
ggcacaggtcgtaaaaatagaattgtgcttgatgatgttaggtctttcgtaaaatccgcg
ctatcagcacctggcggagttacaactggatcttctactttaggcggttcaggattatca
gttcttgattggcctaaagttgatttttctaaatttggtgagatcgacagtaaaccgctt
tctcgtattaagaaaatttcgggagcaaaccttcatagaaattgggtaatgattccacac
gtaaccaataacgatgaagctgatattactgatttagaagctttcagagttcaacttaat
aaagaacatgagaaagctggtattaaatttacaatgcttgcttttatctttaaggctgtt
gttcaagctttgaaaaaatacccagagtttaattcatctattgatggtgaaaatattgtg
tataaaaaatattttcatcttgggtttgctgcagatacacctaatggattagtagtgcct
gtaataagagatgctgataaaaaatccatttcggatatagccaaagaaacctcagaactt
gctaaattagcacgtgatggaaaattgagcccatctcaaatgcaaggtggatgcttcaca
atatcatctttaggaggtattgggggtactcatttcacacctattattaatgcacctgaa
gtggctatattgggcgttagtcgctcataccagaaaccagtttggaatggcaaagaattc
cagcctcgtcttacattgccactatccttgtcatatgatcacaggattattgatggtgca
gctgcagctaggtttaatgtatgtctatgtcaaattttgtctgatttcagaagggctatg
atttaa

DBGET integrated database retrieval system