KEGG   Taylorella equigenitalis MCE9: TEQUI_1548Help
Entry
TEQUI_1548        CDS       T01390                                 

Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00460  Cyanoamino acid metabolism
teq00480  Glutathione metabolism
teq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:teq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    TEQUI_1548
   00460 Cyanoamino acid metabolism
    TEQUI_1548
   00480 Glutathione metabolism
    TEQUI_1548
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:teq01002]
    TEQUI_1548
Enzymes [BR:teq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     TEQUI_1548
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     TEQUI_1548
Peptidases and inhibitors [BR:teq01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   TEQUI_1548
CD molecules [BR:teq04090]
 Proteins
  TEQUI_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADU92460
UniProt: E8UE91
Position
complement(1638503..1640197)
Genome map
AA seq 564 aa AA seqDB search
MKTVLKTLTLLAALTLPAISVEAAVKDPIKDTTTGIVLSTHELANAVGKSVLDKGGNAID
AAVAVGYMLAVVHPAAGNLGGGGFALVHTADGKQVALDFREMAPKGALRDMYLDEQKNVV
DGLSITGHLSAGVPGTVKGMSELLDKYGTMNLSELIQPAIDTARNGFKLTSRQAKSFVEE
KDRMLKYPATKKYFYKEDGSPYKEGEVLKQEDLAKTLERISQNGPDEFYKGETADLIVKD
QEANKGLITKDDLANYKAVWREPVRGTYRGYDIISMSPPSSGGTHIIQILNIMENADIEK
MGALSSETMHLMAEAERQAFADRSEYMGDPDFVKVPVDKLLDKAYAKRIYNRIISQKGKA
IPSDKVKPALDMPYESDQTTHYSVIDSKGNAVSITYTINWSFGSGAAVEGAGFLLNDEMD
DFSAKPGVPNLFGAVGSDANAIEGGKRPLSSMSPTLVLKDGQIFMVVGSPGGTRIITTVL
QVISNVIDHKMNIQKAVAHPRFHMQWLPDELRVEDLTLVKDVENSLIERGYNLKEKPDMG
DVNAIIRDPETGIFYGGKDPRTEF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtattaaaaacactaactctgttggcggctttgacattgccagcaatatct
gtagaagctgcagttaaagatcctataaaggatacgactacaggtattgtgttgagtact
cacgaattagcaaatgcagtgggtaaaagtgttctcgataaagggggtaatgctattgat
gctgcggtagcagtaggatatatgctagccgtggtccatcctgctgcgggtaatttgggg
ggtggtggatttgccctagttcatacagctgatggaaagcaagtagcactagattttcgt
gagatggctcctaagggtgcattgagagatatgtacctagatgagcagaaaaatgtagtt
gatggacttagtataactgggcatctatcagcaggcgtacctggtacagtgaaggggatg
agtgagcttttagataagtatggaactatgaatctttcagagcttattcaacctgcaatt
gatactgcgagaaatggtttcaaactcacttcaagacaagccaaatcatttgtcgaagag
aaggaccgtatgctgaagtatcctgcaactaaaaagtatttctataaagaagatggtagt
ccatataaagagggtgaagtcttaaaacaagaggacctagctaagacattagaaagaatt
tcacaaaatggtcctgatgagttttataagggtgaaactgcagatttaatagttaaagat
caagaagctaataagggtctaattacgaaagatgatttagcaaactataaagcagtttgg
agagagcctgtaagagggacatatcgaggatatgacattatttccatgtctccaccgtca
tcaggtggtactcatataattcaaatcctaaacattatggaaaatgcagatatagaaaag
atgggtgctttatcaagtgaaactatgcacttgatggctgaggcagaacgtcaagcattt
gcagatagatctgaatatatgggggatcctgattttgttaaggtacctgtagataaactt
ttagataaagcttacgcaaaaagaatttacaatcgcattatttctcaaaagggtaaggct
attccaagcgataaagttaaacccgcattagatatgccttatgaatcagatcaaaccaca
cattactctgttatagattctaagggtaatgctgtttctataacttatacgattaactgg
tcatttggttctggtgctgctgttgaaggagcgggttttttattaaacgatgagatggat
gatttctctgccaaaccaggtgtacctaatttgtttggagcagtaggttccgatgctaat
gcaattgagggaggaaagcgaccactatcttctatgtcccctacattagtattaaaagat
ggtcaaatctttatggttgttgggtcgcctggaggtacacgcatcataactacggttttg
caagttatatctaatgttattgatcataagatgaatattcaaaaggcagttgcccatcct
cgttttcatatgcagtggttgccagatgaacttcgtgttgaggatttaactctagttaaa
gatgtagaaaatagtttgattgaaagaggctataaccttaaagaaaaacctgatatgggt
gatgttaatgcaattattagagacccagaaacaggtattttctacggaggtaaagaccct
cgaactgaattttaa

DBGET integrated database retrieval system