KEGG   Trichodesmium erythraeum: Tery_0544Help
Entry
Tery_0544         CDS       T00387                                 

Definition
(GenBank) periplasmic sensor signal transduction histidine kinase
Organism
ter  Trichodesmium erythraeum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABG49994
CyanoBase: Tery_0544
CYORF: Tery_0544
UniProt: Q118T0
Position
complement(858851..860560)
Genome map
AA seq 569 aa AA seqDB search
MSLTSRSKKQSIHQQKSGFKHLLSIIGIRKKIVFGYALGIIIVMLGVLTGQILEFNYKYQ
IRGKIKQGQQEVDLLTNLTKKVLKIIIIQKDVSQKVNNWKILEKKISLELSSFYEVNTIF
KQLKLTLETGDKNISKNTDDVQLEEFIQTYFNPLKIYINQLENLVQDIKQIPPQTKETVE
TASLESLNVIFNSQITIQLQNLSQDSEQLVILANQRVEKQNRDYQKVEKLGIYILICSLL
LSAITTVIIAIYTTNSIITPLKVITKVAEEVTEQANFELQLPVTTNDEIGELTESLNELI
SKVAEYTEQLQEAKLKAEAANRSKSAFLATMSHELRTPLNAIIGYSDILYEDVLEGGYKD
FIPDIERIKLAGKNLLEMISDILDISKIEAGQVTLYLESIEVNKLVKDVFSTAKNITEKN
RNKFELVLGENLGSMYADMPKVKQVLINLLSNAAKFTEDGTITLSVEKVKNNQQKNNQNH
NAKSLSNENYHIVFRVIDTGIGITEEQLKHIFQPFTQADTSTTRKYGGTGLGLAICKRLC
ERMGAEITVKSQLGKGSTFTVWFPEKVLI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaacttccagatcaaaaaaacagtctatccaccagcaaaaaagtggattcaaa
catttgttgagtattataggaatcagaaaaaaaatagtattcggttatgctctgggaatc
attattgtaatgttaggagttttaacagggcagatattggagttcaattataaatatcaa
attagagggaagataaagcaaggtcaacaagaggtagacttattaacaaatcttacaaaa
aaagtattaaaaataattataattcagaaagatgtttcccaaaaagttaataactggaaa
attttagaaaaaaaaatctccctagaattatcaagtttttatgaggttaatacaattttc
aaacaacttaaattaacactagaaaccggagataaaaacatctctaaaaatacagatgat
gttcagcttgaagaatttatccaaacctattttaatcctctaaaaatttatattaatcaa
ttagaaaacttagttcaagacattaaacaaataccgcctcaaacaaaagaaacagtagaa
actgcttcattggaatcactgaatgtaatttttaatagtcaaattacaatacaactacaa
aacttatcgcaagattcagaacaattagtaatactagctaatcagagagtagaaaaacaa
aatagggattatcaaaaagtagaaaaattaggaatatatatattaatatgtagtctacta
ctgtcggcaataactacagtaataatagcaatttataccacaaactcgatcataactccc
ttaaaagtaataactaaagtggctgaagaagttacagaacaagctaattttgaactccaa
cttcctgtaactacaaatgatgaaataggagaattaacagaatctttaaatgagttaatt
agtaaagtagcagaatacacagagcaactccaggaagctaaactcaaagcagaagcagca
aaccgttccaaaagtgcttttctagctaccatgagtcatgaactacgtacacctttaaat
gcaattattggttatagtgatatcctttatgaggatgttctagaaggtggatataaagat
tttattcccgatatagaaagaattaagctagcaggtaaaaacctcctagaaatgattagt
gatatcttagatatttcaaaaatagaagcaggtcaagttacactttatttagagagtatt
gaggttaataagctagttaaagatgtgttcagtacagctaaaaatattactgaaaaaaac
cgtaataaatttgaattagttttaggagaaaatcttggtagtatgtatgcagatatgcca
aaagtgaaacaggtactgataaatttactaagtaatgcagctaagtttacagaagatggt
acaattacactcagtgtagaaaaagttaaaaataatcaacaaaaaaataatcaaaatcac
aatgcaaagtcattaagtaatgaaaactaccatatagtttttcgggtaatagatactggt
attggtataacagaagaacagttaaaacatatattccaaccttttactcaagcagatact
tctactactcgtaagtatggtggtactggtttaggattagcaatatgtaaacgtttatgt
gagagaatgggagcagaaattactgtaaaaagtcaattaggaaaagggtctacatttact
gtttggtttcctgaaaaggtattaatataa

DBGET integrated database retrieval system