KEGG   Trichodesmium erythraeum: Tery_0805Help
Entry
Tery_0805         CDS       T00387                                 

Definition
(GenBank) transcriptional activator, TenA family
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00730  Thiamine metabolism
ter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tery_0805
Enzymes [BR:ter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     Tery_0805
Transcription factors [BR:ter03000]
 Prokaryotic type
  Other transcription factors
   Others
    Tery_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 KilA-N
Motif
Other DBs
NCBI-ProteinID: ABG50222
CyanoBase: Tery_0805
CYORF: Tery_0805
UniProt: Q117V2
Position
1281381..1282022
Genome map
AA seq 213 aa AA seqDB search
MISKNLWKSNQDLATACLCHPFVQGIANGTLPQKSFAYYVGQDAFFLKAFARAYSIAAAK
SDEWKTFELFHTLAGGVKEELELHQTYAAKWGVNLENITPGFATRRYTDFLLATAWGNNI
GAIATAMTPCMRLYAFLGQQLATPKIPEHQYSQWIRTYSTQEFLQLVQNLEKVTDRYAEN
IQETESIYCYAMVCERDFFQAAWEMGKGAYRIH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaaaaaatctttggaaaagtaatcaggacttagcaacagcttgtttgtgtcat
ccttttgtacaaggaattgctaatggtacactaccgcagaaaagttttgcctattatgta
ggacaagatgcctttttcctgaaagcatttgcccgtgcttacagcattgctgctgctaag
tctgacgaatggaaaacatttgaactatttcatacccttgctggtggggtgaaagaagaa
ttagaattgcatcaaacctatgctgctaaatggggagtaaatttagaaaatattacccca
gggtttgccacacggcgttacacagattttttattagcaacggcttggggtaataatatt
ggggcgatcgctacagccatgactccttgtatgcggctctatgcttttttggggcaacag
ttagccacaccaaaaattccagaacaccaatattctcaatggatccgtacttacagcact
caggaatttttacagttagtgcaaaacctagagaaagttacagaccgctacgcagagaat
attcaagaaacagaatcaatttattgttatgccatggtctgcgaacgagatttctttcaa
gcagcttgggaaatgggaaaaggagcataccgtattcattaa

DBGET integrated database retrieval system