KEGG   Trichodesmium erythraeum: Tery_1232Help
Entry
Tery_1232         CDS       T00387                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00790  Folate biosynthesis
ter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tery_1232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ter04147]
    Tery_1232
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Tery_1232
Exosome [BR:ter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tery_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Homoserine_dh
Motif
Other DBs
NCBI-ProteinID: ABG50582
CyanoBase: Tery_1232
CYORF: Tery_1232
UniProt: Q116J2
Position
1907660..1907941
Genome map
AA seq 93 aa AA seqDB search
MTELLAVEEINQRISQISDWKLEGNKLKYIKTVKNFVEAINFVNKLVAPAEASQHHPDLE
VSYNKVTIILTTHNSGGLTEKDFKMAKTISGLS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattgctggctgtagaagaaattaatcaacgtatcagtcaaatatcggactgg
aaattagaaggaaacaagcttaagtatataaaaacagttaaaaattttgttgaagctatt
aattttgtgaataaattagtagctcctgctgaggcttcacaacatcatccagacttagaa
gtatcttacaataaagtgacaatcatattaacaacccataattctggcggcttaacagaa
aaagactttaagatggctaaaacaatatctggcttaagttag

DBGET integrated database retrieval system