KEGG   Trichodesmium erythraeum: Tery_1323Help
Entry
Tery_1323         CDS       T00387                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00220  Arginine biosynthesis
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01130  Biosynthesis of antibiotics
ter01230  Biosynthesis of amino acids
Module
ter_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Tery_1323
Enzymes [BR:ter01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Tery_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ABG50644
CyanoBase: Tery_1323
CYORF: Tery_1323
UniProt: Q116D0
Position
2017345..2018265
Genome map
AA seq 306 aa AA seqDB search
MDKLKGRDLLSLANLNSEELKEILQLAAQLKSGEINLKCNKVLGLLFSKASTRTRVSFTV
AMYQLGGQVIDLNPNVTQVSRGESLEDTARVLDGYLDILAIRTFEQKDLESFANYAKIPV
INALTDREHPCQILADLLTVQENFGKLDGITLSYFGDGNNVANSLLLGCAMVGINVRIAT
PENYLPNKEIVEQAKTIANGKSEVLVTQDPQVAVKDSQVLYTDVWASMGQEQEANNRIPI
FQPYQVNEKLVESAADDVIILHCLPAHRDEEITDAVIEGKKSLVWEQAENRMHAQKALLI
SILGSD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggataaattaaaaggacgagatttattaagtctggcaaacttgaattctgaagaatta
aaagaaattttacaattagcagcccaactaaaatcgggtgaaataaatcttaaatgtaat
aaagtactaggattattattttctaaagcatctacaagaaccagggtaagttttaccgta
gcaatgtatcaattgggaggtcaagttattgatttgaatcctaatgttactcaggttagt
cggggagaaagtttggaagatactgctagggttttagacggatatttagatattttagca
attcgtacttttgaacaaaaagacttagaaagttttgcaaattatgcaaaaattcctgtt
attaatgctcttacagatagggaacatccttgtcagatattagctgatttattaactgtt
caagaaaattttggcaagctagatggaataactttaagttattttggtgatggtaataat
gtggcaaattctttactattaggttgtgcaatggtaggaataaatgtcaggatagcaact
ccagaaaattatctgccaaataaggaaattgtggaacaagcaaagactattgctaatggt
aaaagtgaagttctagttactcaagacccccaggtagcagttaaggatagtcaagtgctt
tatactgatgtttgggcaagcatgggacaagaacaggaagcgaataatcgaattcctatt
tttcagccttatcaagttaatgaaaagttggtagaaagtgcggcagatgatgtaataatt
ttacattgtttaccagcacatagggatgaggaaattactgatgcagtaatagaaggaaag
aaatcactagtttgggagcaagcagaaaatcgaatgcacgctcaaaaagctttattgata
agtatcttaggaagtgattag

DBGET integrated database retrieval system