KEGG   Trichodesmium erythraeum: Tery_1346Help
Entry
Tery_1346         CDS       T00387                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00521  Streptomycin biosynthesis
ter00523  Polyketide sugar unit biosynthesis
ter01130  Biosynthesis of antibiotics
Module
ter_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tery_1346
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tery_1346
Enzymes [BR:ter01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Tery_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABG50660
CyanoBase: Tery_1346
CYORF: Tery_1346
UniProt: Q116B4
Position
complement(2052114..2052659)
Genome map
AA seq 181 aa AA seqDB search
MNVIQTEIPEVLLIEPKVFGDERGFFMESFNQRNFSEKTGVNLEFVQDNHSRSSQGVLRG
LHYQIQQAQGKLLRVVLGEIFDVAVDIRKNSPNFGKWVGYLLSAENKRQLWVPPGFAHGF
FVVSETADVLYKTTDYYAPEYERSILWNDSEIGISWPINGIEVKLSQKDKDGTTLKEADL
M
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaattcaaacagaaattcctgaagtattattaatagagccaaaagtttttgga
gacgaacgtggcttttttatggagagttttaatcaacgtaatttttccgaaaaaacagga
gtaaatctcgaatttgtgcaagataatcattctcgttctagccaaggtgtacttcgaggt
ttgcattatcaaattcaacaagctcaaggcaaattattaagagtagttttgggagaaata
tttgatgttgctgtagacattcggaaaaattctcctaattttggtaagtgggtaggctat
cttttaagtgcagaaaataaacgacaactttgggtgcctcctggttttgctcatggtttt
tttgtagtgtctgaaactgcggatgttttgtataaaactactgattattatgcacctgaa
tatgagcgttcaattctgtggaatgattcagaaattgggattagttggccaataaatgga
attgaggtaaaattgtctcaaaaagataaagatggtacaactttgaaagaggctgatttg
atgtaa

DBGET integrated database retrieval system